DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdkl3

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_006532830.1 Gene:Cdkl3 / 213084 MGIID:2388268 Length:638 Species:Mus musculus


Alignment Length:320 Identity:142/320 - (44%)
Similarity:198/320 - (61%) Gaps:12/320 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111
            |:.||.|.::||||||.|.||:.::||.:||:|.|.| :.:.::.|||.|||:.||..:|.|||:
Mouse     1 MEMYETLGKVGEGSYGTVMKCKHKDTGRIVAIKIFYE-KPEKSVNKIATREIKFLKQFRHENLVN 64

  Fly   112 LLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPE 176
            |:||||:|:::||||||.:.|||.||:.:..|......::..:|.|..:.|.|....:|||||||
Mouse    65 LIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIEYLHNNNIIHRDIKPE 129

  Fly   177 NILLTAQGQVKLCDFGFARML-SPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAEL 240
            |||::..|..|||||||||.| :||:.|||||||||||||||::.||.||.|||:||:||:..|:
Mouse   130 NILVSQSGITKLCDFGFARTLAAPGDVYTDYVATRWYRAPELVLKDTSYGKPVDIWALGCMIIEM 194

  Fly   241 VRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPAKSQQN 305
            ..|....|..||:|.|:.|...:|:|.|....||.::..|.|:.||.....:....|.|   :.|
Mouse   195 ATGHPFLPSSSDLDLLHKIVLKVGNLTPHLHNIFSKSPIFAGVVLPQVQHPKTARKKYP---KLN 256

  Fly   306 PLTIDFLKKCLDKDPTKRWSCEKLTKHSYF--DDYIAKQRELEHVNSLEAANLRQQQLAS 363
            .|..|.:..||..||.:|.|...|.:|.||  |.:|.|     .:..|.|..|::.::.|
Mouse   257 GLLADIVHACLQIDPAERTSSTDLLRHDYFTRDGFIEK-----FIPELRAKLLQEAKVNS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 132/287 (46%)
Pkinase 50..335 CDD:278497 132/285 (46%)
Cdkl3XP_006532830.1 PKc_like 2..286 CDD:419665 132/287 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D398098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.