DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Eif2ak2

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_006523926.1 Gene:Eif2ak2 / 19106 MGIID:1353449 Length:529 Species:Mus musculus


Alignment Length:361 Identity:97/361 - (26%)
Similarity:149/361 - (41%) Gaps:63/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FHSSSFY----LPQSLQNSFLYRLI---------QKIQVCNEPDLVETRQYRPQGSSKMDRYEKL 53
            |.|||..    :.||...||....:         :|..|...||.|:..:|........| :|.:
Mouse   196 FSSSSSMTSNGVSQSAPGSFSSENVFTNGLGENKRKSGVKVSPDDVQRNKYTLDARFNSD-FEDI 259

  Fly    54 SRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLV-------- 110
            ..:|.|.:|.|:|.:.|..|...|:||...:.:.      |..|::.|..|.|.|:|        
Mouse   260 EEIGLGGFGQVFKAKHRIDGKRYAIKRVKYNTEK------AEHEVQALAELNHVNIVQYHSCWEG 318

  Fly   111 -------SLLEVFRRKRR-LHLVFEFCELTVLHE--LERHPQGCPEHLTKQICYQTLLGVAYCHK 165
                   |:.:..|.|.| |.:..|||:...|.:  ..|:.....:.|...:..|.:.||.|.|.
Mouse   319 VDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDLYEQIVTGVEYIHS 383

  Fly   166 QGCLHRDIKPENILLTAQGQVKLCDFGFARML-SPGENYTDYVATRWYRAPELLVGDTQYGTPVD 229
            :|.:|||:||.||.|..:..:|:.|||.|..| :.|::.|....|..|.:||.|. ...||..||
Mouse   384 KGLIHRDLKPGNIFLVDERHIKIGDFGLATALENDGKSRTRRTGTLQYMSPEQLF-LKHYGKEVD 447

  Fly   230 VWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPL 294
            ::|:|.:.|||:  ...:.....:.....:||  ||.   ...||...|  |.:          |
Mouse   448 IFALGLILAELL--HTCFTESEKIKFFESLRK--GDF---SNDIFDNKE--KSL----------L 493

  Fly   295 EDKMPAKSQQNPLTIDFLKKCLD----KDPTKRWSC 326
            :..:..|.:..|.|.:.||...:    .:..||.:|
Mouse   494 KKLLSEKPKDRPETSEILKTLAEWRNISEKKKRNTC 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 83/302 (27%)
Pkinase 50..335 CDD:278497 82/300 (27%)
Eif2ak2XP_006523926.1 DSRM_EIF2AK2_rpt1 21..88 CDD:380732
DSRM_EIF2AK2_rpt2 108..175 CDD:380733
PKc_like 249..514 CDD:389743 80/291 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.