DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdk7

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_038959416.1 Gene:Cdk7 / 171150 RGDID:621124 Length:346 Species:Rattus norvegicus


Alignment Length:257 Identity:113/257 - (43%)
Similarity:147/257 - (57%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFV---ESEDDPAIRKIALREIRLLKNLKH 106
            |:..|||||..||||.:..|||.||:.|..:||:|:..   .||....|.:.|||||:||:.|.|
  Rat     7 SRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSH 71

  Fly   107 PNLVSLLEVFRRKRRLHLVFEFCE--LTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCL 169
            ||::.||:.|..|..:.|||:|.|  |.|:.: :......|.|: |.....||.|:.|.|:...|
  Rat    72 PNIIGLLDAFGHKSNISLVFDFMETDLEVIIK-DNSLVLTPSHI-KAYMLMTLQGLEYLHQHWIL 134

  Fly   170 HRDIKPENILLTAQGQVKLCDFGFARML-SPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAI 233
            |||:||.|:||...|.:||.|||.|:.. ||...||..|.||||||||||.|...||..||:||:
  Rat   135 HRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAV 199

  Fly   234 GCLFAELVRGEALWPGRSDVDQLYLIRKTLG--------DL--LPRHIQIFGQNEYFKGITL 285
            ||:.|||:......||.||:|||..|.:|||        |:  ||.::..    :.|.||.|
  Rat   200 GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTF----KSFPGIPL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 112/254 (44%)
Pkinase 50..335 CDD:278497 111/252 (44%)
Cdk7XP_038959416.1 STKc_CDK7 11..308 CDD:270833 112/253 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.