DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and NEK7

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_016855833.1 Gene:NEK7 / 140609 HGNCID:13386 Length:310 Species:Homo sapiens


Alignment Length:310 Identity:83/310 - (26%)
Similarity:128/310 - (41%) Gaps:58/310 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QYRPQGSSKMD---------RYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESED--DPAIR 91
            |::||.:.:.|         |.||  ::|.|.:..||:......|..||:|: |:..|  |...|
Human    15 QFQPQKALRPDMGYNTLANFRIEK--KIGRGQFSEVYRAACLLDGVPVALKK-VQIFDLMDAKAR 76

  Fly    92 KIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFE------------FCELTVLHELERHPQGC 144
            ...::||.|||.|.|||::.....|.....|::|.|            |..|......::..:..
Human    77 ADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKFLFLIFKKHFKKQKRLI 141

  Fly   145 PEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYT-DYVA 208
            ||....:...|....:.:.|.:..:||||||.|:.:||.|.|||.|.|..|..|...... ..|.
Human   142 PERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVG 206

  Fly   209 TRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQI 273
            |.:|.:|| .:.:..|....|:|::|||..|:...::  |...|...||.:.|.:          
Human   207 TPYYMSPE-RIHENGYNFKSDIWSLGCLLYEMAALQS--PFYGDKMNLYSLCKKI---------- 258

  Fly   274 FGQNEYFKGITLPVPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKR 323
             .|.:|        ||        :|:......|. ..:..|::.||.||
Human   259 -EQCDY--------PP--------LPSDHYSEELR-QLVNMCINPDPEKR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 80/300 (27%)
Pkinase 50..335 CDD:278497 78/289 (27%)
NEK7XP_016855833.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.