DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and AgaP_AGAP002142

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_308053.4 Gene:AgaP_AGAP002142 / 1269416 VectorBaseID:AGAP002142 Length:810 Species:Anopheles gambiae


Alignment Length:339 Identity:71/339 - (20%)
Similarity:119/339 - (35%) Gaps:117/339 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GVVYKCRDRETGALVAVKRFVESED------DPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKR 120
            |||...:.|....|.......||.|      :|.:..:|    .||.|..:.:...||..::   
Mosquito    88 GVVQLTKIRHPQVLTVQHAMEESRDTIAFATEPVVASLA----NLLGNTTNVSNTGLLAEYK--- 145

  Fly   121 RLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQ-GCLHRDIKPENILLTAQG 184
                         |.|.:          ||...::.:.|:.:.|.: ..:||.:..|||::..||
Mosquito   146 -------------LSEFD----------TKFGIFELIKGIRFLHDEVQLVHRHLCTENIIVNKQG 187

  Fly   185 QVKLCDFGF-----------------ARML-SPGENYTDYVATRWYRAPELLVGDTQYGTPVDVW 231
            ..||..|||                 :|:| :||..:|         ||||::.:|         
Mosquito   188 VWKLFGFGFCWSKRAPGTPVGNHPFKSRLLGNPGSKWT---------APELILENT--------- 234

  Fly   232 AIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLED 296
               |:....:......|.......||                 |..:....::...||.|..:.:
Mosquito   235 ---CILIYTIYTRENIPSPDASSDLY-----------------GYKQSVTKLSNQGPPKLTVIPE 279

  Fly   297 KMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYF-DDYIAKQRELEHVNSLEAA----NL 356
            .:.::          :||.|..:|..|.:.:.||:.||| |.|:      :.::|||..    ||
Mosquito   280 SLRSE----------VKKMLSVNPQARPTLQSLTQISYFCDQYV------QCLDSLETLFPKDNL 328

  Fly   357 RQQQLASQQFMLAT 370
            .:.:...:   |||
Mosquito   329 EKSEFYKR---LAT 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 59/297 (20%)
Pkinase 50..335 CDD:278497 59/297 (20%)
AgaP_AGAP002142XP_308053.4 Pkinase 31..308 CDD:278497 59/297 (20%)
PK_SCY1_like 37..310 CDD:270913 61/299 (20%)
HEAT repeat 429..459 CDD:293787
HEAT repeat 468..495 CDD:293787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.