DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdk6

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_034003.1 Gene:Cdk6 / 12571 MGIID:1277162 Length:326 Species:Mus musculus


Alignment Length:334 Identity:122/334 - (36%)
Similarity:190/334 - (56%) Gaps:34/334 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SKMD-RYEKLSRLGEGSYGVVYKCRD-RETGALVAVKRF-VESEDD----PAIRKIALREIRLLK 102
            |:.| :||.::.:|||:||.|:|.|| :..|..||:||. |::.::    ..||::|:  :|.|:
Mouse     7 SRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIREVAV--LRHLE 69

  Fly   103 NLKHPNLVSLLEVFR-----RKRRLHLVFEFCELTVLHELERHPQ-GCPEHLTKQICYQTLLGVA 161
            ..:|||:|.|.:|..     |:.:|.||||..:..:...|::.|: |.|....|.:.:|.|.|:.
Mouse    70 TFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLD 134

  Fly   162 YCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGT 226
            :.|....:|||:||:|||:|:.||:||.|||.||:.|.....|..|.|.||||||:|: .:.|.|
Mouse   135 FLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLL-QSSYAT 198

  Fly   227 PVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLP----V 287
            |||:|::||:|||:.|.:.|:.|.||||||..|...:|  ||      |:.::.:.:.||    .
Mouse   199 PVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIG--LP------GEEDWPRDVALPRQAFH 255

  Fly   288 PPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNSLE 352
            ..:.:|:|..:   :..:.|..|.|.|||..:|.||.|......|.||.|.   :|..:::||..
Mouse   256 SKSAQPIEKFV---TDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDL---ERYKDNLNSHL 314

  Fly   353 AANLRQQQL 361
            .:|....:|
Mouse   315 PSNQSTSEL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 113/303 (37%)
Pkinase 50..335 CDD:278497 112/300 (37%)
Cdk6NP_034003.1 STKc_CDK6 11..300 CDD:270846 112/302 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.