DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdk5

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_031694.1 Gene:Cdk5 / 12568 MGIID:101765 Length:292 Species:Mus musculus


Alignment Length:303 Identity:117/303 - (38%)
Similarity:170/303 - (56%) Gaps:25/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111
            |.:||||.::|||:||.|:|.::|||..:||:||....:||..:...|||||.|||.|||.|:|.
Mouse     1 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVR 65

  Fly   112 LLEVFRRKRRLHLVFEFCELTVLHELERHPQGC-----PEHLTKQICYQTLLGVAYCHKQGCLHR 171
            |.:|....::|.||||||:    .:|:::...|     || :.|...:|.|.|:.:||.:..|||
Mouse    66 LHDVLHSDKKLTLVFEFCD----QDLKKYFDSCNGDLDPE-IVKSFLFQLLKGLGFCHSRNVLHR 125

  Fly   172 DIKPENILLTAQGQVKLCDFGFARMLS-PGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGC 235
            |:||:|:|:...|::||.|||.||... |...|:..|.|.|||.|::|.|...|.|.:|:|:.||
Mouse   126 DLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGC 190

  Fly   236 LFAELVR-GEALWPGRSDVDQLYLIRKTLG----DLLPRHIQIFGQNEYFKGITLPVPPTLEPLE 295
            :||||.. |..|:||....|||..|.:.||    :..|...::.....|      |:.|....|.
Mouse   191 IFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPY------PMYPATTSLV 249

  Fly   296 DKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDY 338
            :.:|   :.|....|.|:..|..:|.:|.|.|:..:|.||.|:
Mouse   250 NVVP---KLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 113/297 (38%)
Pkinase 50..335 CDD:278497 113/295 (38%)
Cdk5NP_031694.1 STKc_CDK5 3..286 CDD:143344 113/296 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.