DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and CLK1

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001155879.1 Gene:CLK1 / 1195 HGNCID:2068 Length:526 Species:Homo sapiens


Alignment Length:356 Identity:100/356 - (28%)
Similarity:160/356 - (44%) Gaps:73/356 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VCNEPDLVETRQYRPQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGAL-VAVK------RFVES 84
            :|...|::..            |||.:..||||::|.|.:|.|.:.|.. ||||      |:.|:
Human   192 ICQSGDVLSA------------RYEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYCEA 244

  Fly    85 EDDPAIRKIALREIRLLKNLK--HPN----LVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQG 143
                     |..||::|::|.  .||    .|.:||.|.....:.:|||...|:. ::..:....
Human   245 ---------ARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIVFELLGLST-YDFIKENGF 299

  Fly   144 CP---EHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQG-------------------QV 186
            .|   :|:.| :.||....|.:.|.....|.|:||||||.....                   .:
Human   300 LPFRLDHIRK-MAYQICKSVNFLHSNKLTHTDLKPENILFVQSDYTEAYNPKIKRDERTLINPDI 363

  Fly   187 KLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRS 251
            |:.|||.|..  ..|:::..|:||.|||||:::. ..:..|.|||:|||:..|...|..::|...
Human   364 KVVDFGSATY--DDEHHSTLVSTRHYRAPEVILA-LGWSQPCDVWSIGCILIEYYLGFTVFPTHD 425

  Fly   252 DVDQLYLIRKTLGDLLPRH-IQIFGQNEYFKGITLP----------VPPTLEPLEDKMPAKSQQN 305
            ..:.|.::.:.||. ||:| ||...:.:||....|.          |....:||::.|.::..::
Human   426 SKEHLAMMERILGP-LPKHMIQKTRKRKYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDVEH 489

  Fly   306 PLTIDFLKKCLDKDPTKRWSCEKLTKHSYFD 336
            ....|.::|.|:.||.||.:..:..||.:||
Human   490 ERLFDLIQKMLEYDPAKRITLREALKHPFFD 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 96/332 (29%)
Pkinase 50..335 CDD:278497 95/330 (29%)
CLK1NP_001155879.1 PKc_CLK1_4 190..519 CDD:271115 98/353 (28%)
S_TKc 203..519 CDD:214567 95/330 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.