DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Tbc1d10c

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_848765.2 Gene:Tbc1d10c / 108995 MGIID:1922072 Length:444 Species:Mus musculus


Alignment Length:204 Identity:46/204 - (22%)
Similarity:63/204 - (30%) Gaps:78/204 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 QGCPEHLTKQICYQTLLGVAYCHKQG----------------------CLHRDIKPENILLTAQG 184
            :|.|..|..: |:..|.|...|.|..                      .|||......:.::.||
Mouse    89 KGIPSALRAR-CWPLLCGARMCQKNNPGTYQELAAAPGDPQWMETIGRDLHRQFPLHEMFVSPQG 152

  Fly   185 QVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALW-- 247
            .      |...:|...:.||.|       .||  .|..|...||    ...|...|...||.|  
Mouse   153 H------GQQGLLQVLKAYTLY-------RPE--QGYCQAQGPV----AAVLLMHLPPEEAFWCL 198

  Fly   248 --------PG---------RSDVDQ-LYLIRKTLGDLLPR---HIQIFGQN------EYFKGI-- 283
                    ||         :.|.:. :.|:|:.    |||   |:|..|..      |:|..:  
Mouse   199 VQICEVYLPGYYGPHMEAVQLDAEVFMALLRRQ----LPRVYKHLQQVGVGPLLYLPEWFLCLFT 259

  Fly   284 -TLPVPPTL 291
             :||.|..|
Mouse   260 RSLPFPTVL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 46/204 (23%)
Pkinase 50..335 CDD:278497 46/204 (23%)
Tbc1d10cNP_848765.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
TBC 87..292 CDD:214540 46/204 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..444
Interaction with calcineurin. /evidence=ECO:0000250 404..444
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.