Sequence 1: | NP_608950.3 | Gene: | CG7236 / 33798 | FlyBaseID: | FBgn0031730 | Length: | 438 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848765.2 | Gene: | Tbc1d10c / 108995 | MGIID: | 1922072 | Length: | 444 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 46/204 - (22%) |
---|---|---|---|
Similarity: | 63/204 - (30%) | Gaps: | 78/204 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 QGCPEHLTKQICYQTLLGVAYCHKQG----------------------CLHRDIKPENILLTAQG 184
Fly 185 QVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALW-- 247
Fly 248 --------PG---------RSDVDQ-LYLIRKTLGDLLPR---HIQIFGQN------EYFKGI-- 283
Fly 284 -TLPVPPTL 291 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7236 | NP_608950.3 | STKc_CDKL1_4 | 48..335 | CDD:270837 | 46/204 (23%) |
Pkinase | 50..335 | CDD:278497 | 46/204 (23%) | ||
Tbc1d10c | NP_848765.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..32 | ||
TBC | 87..292 | CDD:214540 | 46/204 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 383..444 | ||||
Interaction with calcineurin. /evidence=ECO:0000250 | 404..444 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |