DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdk9

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_570930.1 Gene:Cdk9 / 107951 MGIID:1328368 Length:372 Species:Mus musculus


Alignment Length:313 Identity:105/313 - (33%)
Similarity:167/313 - (53%) Gaps:35/313 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLV 110
            ::.:||||:::|:|::|.|:|.:.|:||..||:|:.:...:.......|||||::|:.|||.|:|
Mouse    15 EVTKYEKLAKIGQGTFGEVFKAKHRQTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVV 79

  Fly   111 SLLEVFRRKR--------RLHLVFEFCELTVLHELERHPQGCPEHLT----KQICYQTLLGVAYC 163
            :|:|:.|.|.        .::|||:|||    |:|...........|    |::....|.|:.|.
Mouse    80 NLIEICRTKASPYNRCKGSIYLVFDFCE----HDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYI 140

  Fly   164 HKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGEN-----YTDYVATRWYRAPELLVGDTQ 223
            |:...||||:|..|:|:|..|.:||.|||.||..|..:|     ||:.|.|.|||.||||:|:..
Mouse   141 HRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERD 205

  Fly   224 YGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPR------HIQIFGQNEYFKG 282
            ||.|:|:|..||:.||:.....:..|.::..||.||.:..|.:.|.      ..::|.:.|..||
Mouse   206 YGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDKYELFEKLELVKG 270

  Fly   283 ITLPVPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYF 335
                   ....::|::.| ..::|..:|.:.|.|..||.:|...:....|.:|
Mouse   271 -------QKRKVKDRLKA-YVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 104/309 (34%)
Pkinase 50..335 CDD:278497 104/307 (34%)
Cdk9NP_570930.1 STKc_CDK9 6..315 CDD:270848 104/311 (33%)
T-loop. /evidence=ECO:0000250 166..191 10/24 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.