DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdk20

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_444410.1 Gene:Cdk20 / 105278 MGIID:2145349 Length:346 Species:Mus musculus


Alignment Length:295 Identity:119/295 - (40%)
Similarity:166/295 - (56%) Gaps:13/295 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPN-LV 110
            ||:|..|.|:|||::|:|:|.:..|||.:||:|:......:..|...|||||:.|:.::... :|
Mouse     1 MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGIPNQALREIKALQEIEDSQYVV 65

  Fly   111 SLLEVFRRKRRLHLVFEFCELTVLHELERHPQG--CPEHLTKQICYQTLLGVAYCHKQGCLHRDI 173
            .|..||.......|.|||. |:.|.|:.||.|.  .|..: |......|.|||:||....:|||:
Mouse    66 QLKAVFPHGAGFVLAFEFM-LSDLAEVVRHAQRPLAPAQV-KSYLQMLLKGVAFCHANNIVHRDL 128

  Fly   174 KPENILLTAQGQVKLCDFGFARMLSP--GENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCL 236
            ||.|:|::|.||:|:.|||.||:.||  |..||..||||||||||||.|..||...||:||:||:
Mouse   129 KPANLLISASGQLKIADFGLARVFSPDGGRLYTHQVATRWYRAPELLYGARQYDQGVDLWAVGCI 193

  Fly   237 FAELVRGEALWPGRSDVDQLYLIRKTLGDLLPR-HIQIFGQNEYFKGITLPVPPTLEPLEDKMPA 300
            ..||:.|..|:||.:|::||..:.:.||...|| ..:|....:|.|.......|.  |||:.:|.
Mouse   194 MGELLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPV--PLEEVLPD 256

  Fly   301 KSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYF 335
            .|   |..:|.|.:.|...|.:|.:..:...|.||
Mouse   257 AS---PQALDLLGQFLLYPPRQRIAASQALLHQYF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 116/292 (40%)
Pkinase 50..335 CDD:278497 115/290 (40%)
Cdk20NP_444410.1 STKc_CCRK 3..289 CDD:270826 117/293 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.