DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and PAK4

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001014831.1 Gene:PAK4 / 10298 HGNCID:16059 Length:591 Species:Homo sapiens


Alignment Length:319 Identity:92/319 - (28%)
Similarity:145/319 - (45%) Gaps:56/319 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EPDLVETRQYR-----------PQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVE 83
            ||..|...|:|           |:  |.:|.:.|   :||||.|:|.....|.:|.|||||:...
Human   295 EPQRVSHEQFRAALQLVVDPGDPR--SYLDNFIK---IGEGSTGIVCIATVRSSGKLVAVKKMDL 354

  Fly    84 SEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHL 148
            .:...  |::...|:.::::.:|.|:|.:...:.....|.:|.||.|...|.::..|.:...|.:
Human   355 RKQQR--RELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQI 417

  Fly   149 TKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLS---PGENYTDYVATR 210
            . .:|...|..::..|.||.:|||||.::||||..|:|||.||||...:|   |...  ..|.|.
Human   418 A-AVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRK--SLVGTP 479

  Fly   211 WYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFG 275
            ::.||| |:....||..||:|::|.:..|:|.||..:.....:..:.:||..|            
Human   480 YWMAPE-LISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNL------------ 531

  Fly   276 QNEYFKGITLPVPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSY 334
                        ||.|:.|....|:..       .||.:.|.:||.:|.:..:|.||.:
Human   532 ------------PPRLKNLHKVSPSLK-------GFLDRLLVRDPAQRATAAELLKHPF 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 85/290 (29%)
Pkinase 50..335 CDD:278497 84/288 (29%)
PAK4NP_001014831.1 CRIB_PAK_like 10..55 CDD:238526
Linker 25..320 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..301 3/5 (60%)
GEF-interaction domain (GID) 298..323 5/26 (19%)
STKc_PAK4 300..591 CDD:132988 89/314 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.