DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12511 and fundc2

DIOPT Version :9

Sequence 1:NP_608949.2 Gene:CG12511 / 33797 FlyBaseID:FBgn0031729 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001005954.1 Gene:fundc2 / 792181 ZFINID:ZDB-GENE-041010-26 Length:147 Species:Danio rerio


Alignment Length:112 Identity:29/112 - (25%)
Similarity:53/112 - (47%) Gaps:16/112 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQIGMGAAGGFLTGFVLLKASKIMAVAAGGTILALELAWQAGLVQLDVLKTFSQLEQDQSRGQLE 85
            :|:.:|...|:..|::..|..|:.|.|.||....|::|...|.:::|    :.::|.|.::.:.:
Zfish    44 TQLAIGRVSGWCAGYLFQKVGKVAASAVGGGFFLLQIAHHTGYIKID----WKRVEHDVNKAKKQ 104

  Fly    86 VREISLEP-----VNLNRVQELGDKARKACATSGRLCVAFLGGFLLG 127
            ::..|.:|     ...|.||..   .:.....:|    .|.||||||
Zfish   105 LKLNSDKPPKEVTTKFNEVQLF---VKNNIVLTG----GFAGGFLLG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12511NP_608949.2 FUN14 23..119 CDD:282747 21/100 (21%)
fundc2NP_001005954.1 FUN14 46..134 CDD:282747 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103323
Panther 1 1.100 - - O PTHR21346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.