DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12511 and Fundc1

DIOPT Version :9

Sequence 1:NP_608949.2 Gene:CG12511 / 33797 FlyBaseID:FBgn0031729 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_082334.1 Gene:Fundc1 / 72018 MGIID:1919268 Length:155 Species:Mus musculus


Alignment Length:109 Identity:36/109 - (33%)
Similarity:58/109 - (53%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQIGMGAAGGFLTGFVLLKASKIMAVAAGGTILALELAWQAGLVQLDVLKTFSQLEQD--QSRGQ 83
            :||.||...|:..||:..|..|:.|.|.||..|.|::|..:|.||:|    :.::|:|  :::.|
Mouse    52 TQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQVASHSGYVQID----WKRVEKDVNKAKRQ 112

  Fly    84 LEVREISLEPVNLNRVQELGDKARKACATSGRLCVAFLGGFLLG 127
            ::.|.....|...|.::|..|..::....|.    .|:||||||
Mouse   113 IKKRANKAAPEINNIIEEATDFIKQNIVISS----GFVGGFLLG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12511NP_608949.2 FUN14 23..119 CDD:282747 28/97 (29%)
Fundc1NP_082334.1 YXXL 18..21
FUN14 54..153 CDD:398543 35/107 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4099
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103323
Panther 1 1.100 - - O PTHR21346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.