DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12511 and FUNDC2

DIOPT Version :9

Sequence 1:NP_608949.2 Gene:CG12511 / 33797 FlyBaseID:FBgn0031729 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_076423.2 Gene:FUNDC2 / 65991 HGNCID:24925 Length:189 Species:Homo sapiens


Alignment Length:118 Identity:35/118 - (29%)
Similarity:64/118 - (54%) Gaps:11/118 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SLSQRSPYSQIGMGAAGGFLTGFVLLKASKIMAVAAGGTILALELAWQAGLVQLDVLKTFSQLEQ 77
            |..:.|..:|:.:|...|:.|||:..|..|:.|.|.||....|:||...|.:::|    :.::|:
Human    77 SAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVD----WQRVEK 137

  Fly    78 D--QSRGQLEVREISLEPVNL-NRVQELGDKARKACATSGRLCVAFLGGFLLG 127
            |  :::.||::|:.:..|..: ::.:|:....:|....:|    .|.||||||
Human   138 DMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTG----GFFGGFLLG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12511NP_608949.2 FUN14 23..119 CDD:282747 25/98 (26%)
FUNDC2NP_076423.2 FUN14 87..173 CDD:309869 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4099
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5376
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.