DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12511 and FUNDC1

DIOPT Version :9

Sequence 1:NP_608949.2 Gene:CG12511 / 33797 FlyBaseID:FBgn0031729 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_776155.1 Gene:FUNDC1 / 139341 HGNCID:28746 Length:155 Species:Homo sapiens


Alignment Length:109 Identity:35/109 - (32%)
Similarity:58/109 - (53%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQIGMGAAGGFLTGFVLLKASKIMAVAAGGTILALELAWQAGLVQLDVLKTFSQLEQD--QSRGQ 83
            :||.||...|:..||:..|..|:.|.|.||..|.|::|..:|.||:|    :.::|:|  :::.|
Human    52 TQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQID----WKRVEKDVNKAKRQ 112

  Fly    84 LEVREISLEPVNLNRVQELGDKARKACATSGRLCVAFLGGFLLG 127
            ::.|.....|...|.::|..:..::....|.    .|:||||||
Human   113 IKKRANKAAPEINNLIEEATEFIKQNIVISS----GFVGGFLLG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12511NP_608949.2 FUN14 23..119 CDD:282747 27/97 (28%)
FUNDC1NP_776155.1 YXXL 18..21
FUN14 54..153 CDD:309869 34/107 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4099
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5376
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103323
Panther 1 1.100 - - O PTHR21346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.