DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12511 and fundc1

DIOPT Version :9

Sequence 1:NP_608949.2 Gene:CG12511 / 33797 FlyBaseID:FBgn0031729 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001120476.1 Gene:fundc1 / 100145592 XenbaseID:XB-GENE-964323 Length:151 Species:Xenopus tropicalis


Alignment Length:110 Identity:35/110 - (31%)
Similarity:60/110 - (54%) Gaps:12/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQIGMGAAGGFLTGFVLLKASKIMAVAAGGTILALELAWQAGLVQLDVLKTFSQLEQDQSRGQLE 85
            :||.||...|:..||:..|..|:.|.|.||..|.|::|...|.:|:|    :.::|:|.::.:.:
 Frog    48 TQIVMGGVSGWCAGFLFQKVGKLAATAVGGGFLLLQIASHGGYIQID----WKRVEKDVNKAKRK 108

  Fly    86 VRE---ISLEPVNLNRVQELGDKARKACATSGRLCVAFLGGFLLG 127
            :::   .|:..:| ..::|..|..:|....||    .|:||||||
 Frog   109 IKKEANKSVPEIN-TLIEESTDFIKKNIVVSG----GFVGGFLLG 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12511NP_608949.2 FUN14 23..119 CDD:282747 27/98 (28%)
fundc1NP_001120476.1 YXXL 14..17
FUN14 50..138 CDD:282747 25/92 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.