DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp60C and AT1G67760

DIOPT Version :10

Sequence 1:NP_608948.2 Gene:Hsp60C / 33796 FlyBaseID:FBgn0031728 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_176942.2 Gene:AT1G67760 / 843101 AraportID:AT1G67760 Length:120 Species:Arabidopsis thaliana


Alignment Length:32 Identity:10/32 - (31%)
Similarity:16/32 - (50%) Gaps:1/32 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 IKMSDFGRVGEVVVSKDDTMLLKG-KGQKAEV 367
            :...:|||...::..:|....||| ..|||.:
plant     3 LAFDEFGRPFIILREQDQKTRLKGIDAQKANI 34

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp60CNP_608948.2 GroEL 28..548 CDD:239460 10/32 (31%)
AT1G67760NP_176942.2 chaperonin_like 2..>55 CDD:351886 10/32 (31%)
chaperonin_like <78..107 CDD:351886
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.