DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp60C and MKKS

DIOPT Version :9

Sequence 1:NP_608948.2 Gene:Hsp60C / 33796 FlyBaseID:FBgn0031728 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_061336.1 Gene:MKKS / 8195 HGNCID:7108 Length:570 Species:Homo sapiens


Alignment Length:198 Identity:47/198 - (23%)
Similarity:74/198 - (37%) Gaps:65/198 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 NLISEAIKKVGRDGVITVKDGK---TLCDELEVIEGMKFDRGYISPYFINTSKGAK--VEFQDAL 243
            ||| |.::::|......::..|   :||               || |..:.:.|.:  |:|....
Human   101 NLI-ENVQRLGLTPTTVIRLNKHLLSLC---------------IS-YLKSETCGCRIPVDFSSTQ 148

  Fly   244 LLFCEKKIKSAPSIVPALELANAQRKPLVIIAEDLEAEALSTLVVNRLKVGLQVCAVKAPG---F 305
            :|.|  .::|..:..||..|.   ||         |.|.:|.|:   |:..|......|.|   .
Human   149 ILLC--LVRSILTSKPACMLT---RK---------ETEHVSALI---LRAFLLTIPENAEGHIIL 196

  Fly   306 GDN-----RKENLMDMAVATGGIVFGDEANMVRLEDIK-----------------MSDFGRVGEV 348
            |.:     :.:.::|..|..|.::...|..::||..||                 .||.|. |.|
Human   197 GKSLIVPLKGQRVIDSTVLPGILIEMSEVQLMRLLPIKKSTALKVALFCTTLSGDTSDTGE-GTV 260

  Fly   349 VVS 351
            |||
Human   261 VVS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp60CNP_608948.2 PTZ00114 23..553 CDD:185455 47/198 (24%)
GroEL 28..548 CDD:239460 47/198 (24%)
MKKSNP_061336.1 Cpn60_TCP1 29..569 CDD:278544 47/198 (24%)
chaperonin_like 32..476 CDD:295468 47/198 (24%)
Substrate-binding apical domain 198..370 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.