Sequence 1: | NP_608948.2 | Gene: | Hsp60C / 33796 | FlyBaseID: | FBgn0031728 | Length: | 576 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061336.1 | Gene: | MKKS / 8195 | HGNCID: | 7108 | Length: | 570 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 47/198 - (23%) |
---|---|---|---|
Similarity: | 74/198 - (37%) | Gaps: | 65/198 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 184 NLISEAIKKVGRDGVITVKDGK---TLCDELEVIEGMKFDRGYISPYFINTSKGAK--VEFQDAL 243
Fly 244 LLFCEKKIKSAPSIVPALELANAQRKPLVIIAEDLEAEALSTLVVNRLKVGLQVCAVKAPG---F 305
Fly 306 GDN-----RKENLMDMAVATGGIVFGDEANMVRLEDIK-----------------MSDFGRVGEV 348
Fly 349 VVS 351 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hsp60C | NP_608948.2 | PTZ00114 | 23..553 | CDD:185455 | 47/198 (24%) |
GroEL | 28..548 | CDD:239460 | 47/198 (24%) | ||
MKKS | NP_061336.1 | Cpn60_TCP1 | 29..569 | CDD:278544 | 47/198 (24%) |
chaperonin_like | 32..476 | CDD:295468 | 47/198 (24%) | ||
Substrate-binding apical domain | 198..370 | 16/67 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0459 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |