DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and opcml

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001072487.1 Gene:opcml / 779942 XenbaseID:XB-GENE-5831850 Length:346 Species:Xenopus tropicalis


Alignment Length:340 Identity:104/340 - (30%)
Similarity:162/340 - (47%) Gaps:45/340 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 HIAHHLAEMQNK--DELLEDIREDTVVNAIP----EKDLPKFGELLQNVTVPVSREAVLQCVVDN 155
            |:.||:..|...  ..||.       :..:|    :...||   .:.||||.....|:|:|.|||
 Frog     9 HLYHHVCWMFGAALTVLLS-------ITGVPVRSGDAGFPK---AMDNVTVRQGDSAILRCTVDN 63

  Fly   156 LQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTD--P 218
            ..| ::|||  :..|||...|...:.:.|:.:....|..:.:.|::|...|:|.|.|.:.||  |
 Frog    64 RVT-RVAWL--NRSTILYTGNDKWSIDPRVVLLANTKSQYSIEIQNVDIYDEGPYTCSVQTDNHP 125

  Fly   219 MKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEA 283
            ..|:| :|.|.|.|.||:  .|:|:.:.|||.|.|:|.|||.|.|.:|||...|:       :..
 Frog   126 KTSRV-HLIVQVAPQILN--ISSDITVNEGSTVALRCLATGRPEPAVTWRHFTGK-------SHR 180

  Fly   284 VAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLE 348
            ...:..:|.|..:.|...|.|.|.|:|.:.....::|.:.|::||.| ...:..||:|.|...|.
 Frog   181 FVSDDEYLEITGITRDQSGQYECSAANDVSAPDIRKVRVTVNYPPYI-SDTRNTGASLGQKGILR 244

  Fly   349 CQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMR-----LTIYEVDIQDFGAYRCVAKN 408
            |.:.|.|.:...|.:.:|.:..|        ..|.:|..:     ||.:.|..:|:|.|.|||.|
 Frog   245 CSASAVPLAEFQWYREETRLANG--------LDGVRIENKDHMSILTFFNVSEKDYGNYTCVASN 301

  Fly   409 SLGDTDGAIKLYHIP 423
            .||:::.::.||..|
 Frog   302 KLGNSNASVILYAGP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 33/94 (35%)
IG_like 137..230 CDD:214653 33/94 (35%)
IG_like 240..324 CDD:214653 26/83 (31%)
IGc2 247..310 CDD:197706 22/62 (35%)
Ig 327..419 CDD:299845 28/96 (29%)
IG_like 343..420 CDD:214653 22/81 (27%)
opcmlNP_001072487.1 Ig 46..134 CDD:325142 32/91 (35%)
Ig_3 138..207 CDD:316449 27/77 (35%)
ig 228..312 CDD:278476 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55663
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.