DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and ntm

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001003852.2 Gene:ntm / 678534 ZFINID:ZDB-GENE-060421-6020 Length:375 Species:Danio rerio


Alignment Length:348 Identity:102/348 - (29%)
Similarity:164/348 - (47%) Gaps:35/348 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIR 200
            :.|:|:.......|.|...:..|: .|||  :..:||.......:.:.|:|:....:..:.::|.
Zfish    37 MDNITIRQGETLFLSCSQGDFVTH-TAWL--NRSSILYAGEDKWSVDPRVSLVTLSQEEFTIKIE 98

  Fly   201 DVKESDKGWYMCQINTD--PMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTP 263
            ||..:|:|.|:|.:.|.  |..:.| ::.|.|||.|::  .|.|:|:.|||||||.|.|.|.|.|
Zfish    99 DVDVTDEGQYICAVQTSSRPRTTSV-HIIVQVPPKIVN--LSRDLVVNEGSNVTLMCLANGKPEP 160

  Fly   264 TITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPP 328
            .|.||.:.      |:. ::::.:...|.|..::|...|.|.|.|:|.| ...::.|.|.|::.|
Zfish   161 AIVWRMKS------PSD-DSLSSDSEVLDIPFISRYRAGVYECTAANDI-AVDTQTVELTVNYAP 217

  Fly   329 MIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKI-----TMR 388
            .: ...:.||..|.|...|:|:::|.|::...|.::|..|..|        ..|.:|     ..|
Zfish   218 SV-SDGRDVGVTLGQRGVLQCEADAVPEADFEWYRDDRRIFNG--------LDGIEIEAAGALSR 273

  Fly   389 LTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVPVVLVKYNKEQRY 453
            ||.:.|...|:|.|.|||.|.||..:.:..||.|.:.|:.|.:    .:.|.|.||...:.:...
Zfish   274 LTFFNVSEADYGNYTCVAINKLGSANTSFVLYEIIEPTSSTLL----QVETSPSVLEMTSSDLEQ 334

  Fly   454 GSSQNSN-TNPYNFNPGNSQQNT 475
            ...||.. ..|.....|||..:|
Zfish   335 TPLQNDLWEGPGAVQDGNSGTST 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 23/94 (24%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 32/91 (35%)
Ig strand B 251..255 CDD:409275 3/3 (100%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 25/85 (29%)
ntmNP_001003852.2 Ig 39..127 CDD:472250 22/91 (24%)
Ig strand B 48..52 CDD:409353 1/3 (33%)
Ig strand C 60..64 CDD:409353 1/4 (25%)
Ig strand E 93..97 CDD:409353 0/3 (0%)
Ig strand F 107..112 CDD:409353 2/4 (50%)
Ig strand G 120..123 CDD:409353 0/2 (0%)
Ig_3 130..200 CDD:464046 29/78 (37%)
Ig 223..304 CDD:472250 27/88 (31%)
Ig strand B 233..237 CDD:409353 1/3 (33%)
Ig strand C 246..250 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 2/3 (67%)
Ig strand F 286..291 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.