DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Tmigd1

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001369175.1 Gene:Tmigd1 / 66601 MGIID:1913851 Length:294 Species:Mus musculus


Alignment Length:251 Identity:60/251 - (23%)
Similarity:103/251 - (41%) Gaps:66/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 RMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPP-----DILDYPTSTDM 243
            |.|..|:.|..|.:                  |.|:::....|.|:..|     .:|.....|:.
Mouse    25 RRSNLHSLKMVWKI------------------TGPLQACQLLLVVLSLPQGRTSSVLTVNGRTEN 71

  Fly   244 VI---REGSNVTLKCAATG-SPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAY 304
            .|   :.|...:|:||... :....:.|.||.| ::.|.||                |::|:.: 
Mouse    72 YILDTQHGVQASLECAVQNHTEDEELLWYREDG-IVDLKNG----------------NKINISS- 118

  Fly   305 LCI-----ASNGI--------PPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPK 356
            :|:     :.||:        ..|||..|:|.|.|||:: ..|.........:::|.|..::.|:
Mouse   119 VCVSPINESDNGVRFTCKLQRDQTVSVTVVLNVTFPPLL-SGNGFQTVEENSDVSLVCNVKSNPQ 182

  Fly   357 SINYWMKNDTIIV--PGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSL 410
            :...|.||::.:|  .|...:.:|.||     .:|:|.:|...|.|.|.|:|.:||
Mouse   183 AQMMWYKNNSALVLEKGRHQIHQTRES-----FQLSITKVKKSDNGTYSCIASSSL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 9/45 (20%)
Ig strand B 147..151 CDD:409353
Ig strand C 160..164 CDD:409353
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 0/4 (0%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 25/113 (22%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 0/3 (0%)
Ig strand F 303..308 CDD:409275 1/9 (11%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 22/82 (27%)
Tmigd1NP_001369175.1 IG_like 163..244 CDD:214653 21/76 (28%)
Ig strand B 171..175 CDD:409353 1/3 (33%)
Ig strand C 184..188 CDD:409353 0/3 (0%)
Ig strand E 210..214 CDD:409353 1/3 (33%)
Ig strand F 224..229 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.