DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Tmigd1

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001369175.1 Gene:Tmigd1 / 66601 MGIID:1913851 Length:294 Species:Mus musculus


Alignment Length:251 Identity:60/251 - (23%)
Similarity:103/251 - (41%) Gaps:66/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 RMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPP-----DILDYPTSTDM 243
            |.|..|:.|..|.:                  |.|:::....|.|:..|     .:|.....|:.
Mouse    25 RRSNLHSLKMVWKI------------------TGPLQACQLLLVVLSLPQGRTSSVLTVNGRTEN 71

  Fly   244 VI---REGSNVTLKCAATG-SPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAY 304
            .|   :.|...:|:||... :....:.|.||.| ::.|.||                |::|:.: 
Mouse    72 YILDTQHGVQASLECAVQNHTEDEELLWYREDG-IVDLKNG----------------NKINISS- 118

  Fly   305 LCI-----ASNGI--------PPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPK 356
            :|:     :.||:        ..|||..|:|.|.|||:: ..|.........:::|.|..::.|:
Mouse   119 VCVSPINESDNGVRFTCKLQRDQTVSVTVVLNVTFPPLL-SGNGFQTVEENSDVSLVCNVKSNPQ 182

  Fly   357 SINYWMKNDTIIV--PGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSL 410
            :...|.||::.:|  .|...:.:|.||     .:|:|.:|...|.|.|.|:|.:||
Mouse   183 AQMMWYKNNSALVLEKGRHQIHQTRES-----FQLSITKVKKSDNGTYSCIASSSL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 9/45 (20%)
IG_like 137..230 CDD:214653 9/45 (20%)
IG_like 240..324 CDD:214653 23/100 (23%)
IGc2 247..310 CDD:197706 14/68 (21%)
Ig 327..419 CDD:299845 24/86 (28%)
IG_like 343..420 CDD:214653 21/70 (30%)
Tmigd1NP_001369175.1 IG_like 163..244 CDD:214653 21/76 (28%)
Ig strand B 171..175 CDD:409353 1/3 (33%)
Ig strand C 184..188 CDD:409353 0/3 (0%)
Ig strand E 210..214 CDD:409353 1/3 (33%)
Ig strand F 224..229 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.