DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and CG34353

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:493 Identity:134/493 - (27%)
Similarity:210/493 - (42%) Gaps:81/493 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EDTVVNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITK 181
            |.....::..|:.|.|....:..........||.|.|.|..||.:||.|  ...|||..:..:|.
  Fly    73 ESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKR--GIAILTAGSVKVTP 135

  Fly   182 NHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIR 246
            :.|:.:.:    .:.|:|||...:|.|.|:|||.|...:.....::::|||.|....|...:.::
  Fly   136 DPRVRLVN----GFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVK 196

  Fly   247 EGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNG 311
            :||:|.::|:|||:|.|.:||.|:..   .||||.|.:  :...|:|..|:|...|.|:|.|:|.
  Fly   197 KGSSVRIECSATGNPMPNVTWSRKNN---ILPNGEEKL--HSHVLSIENVDRHKGGVYICTANNR 256

  Fly   312 IPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLEC--QSEAYPKSINYWMKNDTIIVPGERF 374
            :....|.:|:|.|.|.|.|.::..:|.:......||.|  ..|..|:.|  |.|:...:...||.
  Fly   257 VGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVI--WFKDTMQLDTTERH 319

  Fly   375 VPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSI-N 438
            :.||..|.:.:.:|    :|..||||.|.|||:|.||..          :.|...:..|.|:: |
  Fly   320 IMETRGSRHTLIIR----KVHPQDFGNYSCVAENQLGKA----------RKTLQLSGKPNVAVFN 370

  Fly   439 TVPVVLVKYNKEQRYGSSQNSNTNPYNFNPGNSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATS 503
            :.|:...|......:....:|....|..:      ..||.:|               :..||   
  Fly   371 SPPISQYKDRYNISWAVDSHSPIEEYKLS------FRKLPQG---------------HEVVG--- 411

  Fly   504 SLWNSQDHHSSSSSSSSASSR--GRDHHQQQHHQQQQQNHGSDHGASYRSDGKSPHLTNHDAKSL 566
               |:.|..|||||.||:||:  |...|..:.........|.....||...|...|..::|    
  Fly   412 ---NAIDSSSSSSSMSSSSSQMYGSGLHAHRIGSNMGGLSGLSGSGSYSGYGNVIHWGHND---- 469

  Fly   567 TDDLDRMQDLKGWASRLSPISPI-----LGLS-MILGV 598
                        |.:.:.|..|:     .|:| |:.|:
  Fly   470 ------------WRNVVLPAVPVSHHYAQGMSYMVRGL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 26/92 (28%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 32/91 (35%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 26/82 (32%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 26/85 (31%)
Ig strand B 103..107 CDD:409353 2/3 (67%)
Ig strand C 116..120 CDD:409353 1/3 (33%)
Ig strand E 145..149 CDD:409353 1/3 (33%)
Ig strand F 159..164 CDD:409353 2/4 (50%)
Ig strand G 173..176 CDD:409353 0/2 (0%)
Ig 182..269 CDD:472250 32/91 (35%)
Ig strand B 201..205 CDD:409353 1/3 (33%)
Ig strand C 214..218 CDD:409353 1/3 (33%)
Ig strand F 248..253 CDD:409353 2/4 (50%)
Ig strand G 262..265 CDD:409353 1/2 (50%)
Ig_3 273..349 CDD:464046 26/81 (32%)
FN3 <466..524 CDD:238020 8/46 (17%)

Return to query results.
Submit another query.