DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and hmcn2

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_001920501.5 Gene:hmcn2 / 565032 ZFINID:ZDB-GENE-030131-9765 Length:4212 Species:Danio rerio


Alignment Length:507 Identity:121/507 - (23%)
Similarity:186/507 - (36%) Gaps:158/507 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QESDDEGELHHLDQMHHQHQ----DFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVNAIPE 126
            |..::.||    |:||:..:    ..|.|::                ||.::|:  |||||:...
Zfish  1814 QAVNEAGE----DKMHYDLEVLVPPVISGQT----------------DEFMQDV--DTVVNSTVS 1856

  Fly   127 ----------------KD-LPKF----------GELLQNVTVPVSREAVLQCVVDNL-----QTY 159
                            || ||.:          |:||:.|.|.||..|..|||.:|.     :.|
Zfish  1857 LRCDVSGHPSPSVSWIKDGLPLYSDSRHNILEDGKLLEIVNVQVSDGASYQCVAENKAGAVERLY 1921

  Fly   160 KIAWLRVDTQTI-------LTIQNHVI----------------TKNHRM----SITHAEKRAWIL 197
            .:: ::|..:.:       ..::.|:|                ||:.:|    :..|......:|
Zfish  1922 SLS-IQVPPRIVGRREEEMSVVEGHMISLLCDVQAYPPADIIWTKDGQMLEFTTGIHILPGGQML 1985

  Fly   198 RIRDVKESDKGWYMCQINTDPMKSQ------VGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCA 256
            :|....:.|.|.|:|.......:.|      :..|..:||....:....|.:|   ||.:.|:|.
Zfish  1986 QIPRAGQQDAGQYVCTATNSAGQDQKSILLTIYALPALVPRLESESEVRTPLV---GSTLILRCE 2047

  Fly   257 ATGSPTPTITWRREGGELIPLPNGAEAVAYNG-----SFLTIAKVNRLNMGAYLCIASNGIPPTV 316
            |.|.|.|.:||.|         ||.:..|.||     ..|.|..|...:.|.|.|..|| |...|
Zfish  2048 ANGIPKPEVTWYR---------NGLQLAAGNGLRIERQQLEIVGVQVADGGVYTCKVSN-IAGQV 2102

  Fly   317 SKRVMLIVHFPPMIWIQNQLVGAALTQN----ITLECQSEAYPKSINYWMKNDTIIVPGERFVPE 377
            .:...:.||.||   :....:...||||    |||.|::...|.....|:|:.:.|....::...
Zfish  2103 DRTFRVTVHVPP---VMEGPLHETLTQNLGSHITLICEASGIPVPNIAWLKDGSPIESSLQWNWS 2164

  Fly   378 TFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDT--DGAIKLYHIP----------------- 423
            |..:      ||.:..:.:...|.|.|:|||:.|.|  |.::.:|..|                 
Zfish  2165 TRAN------RLELGPLQLSHAGTYTCIAKNTEGQTQKDYSLTIYAPPSIIDSGHPSEVSAPVGE 2223

  Fly   424 ----QTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNPYNFNPGNS 471
                :...|.:.||.||.......||            |.||...|.:|..|
Zfish  2224 ELALECRAMGSPAPKVSWLRNGKTLV------------NGNTEHINISPDGS 2263

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 25/130 (19%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/8 (13%)
Ig 232..324 CDD:472250 28/96 (29%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 21/84 (25%)
hmcn2XP_001920501.5 Ig strand F 1221..1226 CDD:409570
Ig strand G 1234..1237 CDD:409570
Ig 1245..1335 CDD:472250
Ig strand B 1263..1267 CDD:409570
Ig strand C 1276..1280 CDD:409570
Ig strand E 1301..1305 CDD:409570
Ig strand F 1315..1320 CDD:409570
Ig strand G 1328..1331 CDD:409570
Ig 1338..1430 CDD:472250
Ig strand B 1358..1362 CDD:409353
Ig strand C 1371..1375 CDD:409353
Ig strand E 1394..1398 CDD:409353
Ig strand F 1408..1413 CDD:409353
Ig strand G 1421..1424 CDD:409353
I-set 1443..1523 CDD:400151
Ig strand B 1451..1455 CDD:409353
Ig strand C 1464..1468 CDD:409353
Ig strand E 1488..1493 CDD:409353
Ig strand F 1503..1508 CDD:409353
I-set 1538..1608 CDD:400151
Ig strand B 1546..1550 CDD:409353
Ig strand C 1559..1563 CDD:409353
Ig strand E 1582..1586 CDD:409353
Ig strand F 1596..1601 CDD:409353
Ig strand G 1610..1613 CDD:409353
ChlD <21..206 CDD:440853
IG_like 441..512 CDD:214653
Ig 516..603 CDD:472250
Ig strand B 533..537 CDD:409353
Ig strand C 546..550 CDD:409353
Ig strand E 569..573 CDD:409353
Ig strand F 583..588 CDD:409353
Ig strand G 596..599 CDD:409353
Ig_3 607..680 CDD:464046
I-set 711..784 CDD:400151
Ig strand B 714..718 CDD:409353
Ig strand C 727..731 CDD:409353
Ig strand E 750..754 CDD:409353
Ig strand F 764..769 CDD:409353
Ig strand G 777..780 CDD:409353
IG_like 794..879 CDD:214653
Ig strand B 805..809 CDD:409353
Ig strand C 818..822 CDD:409353
Ig strand E 845..849 CDD:409353
Ig strand F 859..864 CDD:409353
Ig strand G 872..875 CDD:409353
Ig 885..972 CDD:472250
Ig strand C 916..920 CDD:409353
Ig strand E 938..942 CDD:409353
Ig strand F 952..957 CDD:409353
Ig strand G 965..968 CDD:409353
Ig_3 975..1049 CDD:464046
IG_like 1083..1159 CDD:214653
Ig strand B 1089..1093 CDD:409353
Ig strand C 1102..1106 CDD:409353
Ig strand E 1125..1129 CDD:409353
Ig strand F 1139..1144 CDD:409353
Ig strand G 1152..1155 CDD:409353
I-set 1163..1241 CDD:400151
Ig strand B 1180..1184 CDD:409570
Ig strand C 1193..1197 CDD:409570
Ig strand E 1208..1211 CDD:409570
Ig 1637..1714 CDD:472250
Ig strand B 1644..1648 CDD:409353
Ig strand C 1657..1661 CDD:409353
Ig strand E 1680..1684 CDD:409353
Ig strand F 1694..1699 CDD:409353
IG_like 1753..1830 CDD:214653 6/19 (32%)
Ig strand B 1760..1764 CDD:409353
Ig strand C 1773..1777 CDD:409353
Ig strand E 1796..1800 CDD:409353