DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and olfml2ba

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001038314.1 Gene:olfml2ba / 557997 ZFINID:ZDB-GENE-041014-329 Length:883 Species:Danio rerio


Alignment Length:263 Identity:54/263 - (20%)
Similarity:82/263 - (31%) Gaps:92/263 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 RAWILRIRDVKESDKGWYMCQINTDPMKSQ---VGYLDVVVPPDILDYPTSTDMVIREGSNVTLK 254
            :||.:|.:...|..||      ...|.|.|   :|.||....|  :..||....|..:.|:.|..
Zfish   332 KAWSVRPKTKSEISKG------GDAPKKHQNPLMGLLDSTALP--IKTPTEPITVQTQTSHSTTD 388

  Fly   255 CAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKR 319
             ::||....|.|                ..|.:...:|.:.:.|:.       |:...|||    
Zfish   389 -SSTGDERTTTT----------------PAAMDNLKVTKSSIKRME-------ANKVEPPT---- 425

  Fly   320 VMLIVHFPPMIWIQNQLVGAA------LTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPET 378
                   |.:...||.||.::      ..:::....:.||...:    |.|.|    ....|.||
Zfish   426 -------PSVQQAQNMLVRSSNLGHIKTNESVAAAVKVEATEPT----MTNQT----NGTAVKET 475

  Fly   379 FESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMT----TMAPTVSINT 439
            ..|....|                            ||:...|:..:|..|    |.:||...|.
Zfish   476 SASSVTQT----------------------------GALIKEHLKASTQSTLNTLTPSPTSHSNA 512

  Fly   440 VPV 442
            :.|
Zfish   513 LTV 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 12/39 (31%)
IG_like 137..230 CDD:214653 12/39 (31%)
IG_like 240..324 CDD:214653 14/83 (17%)
IGc2 247..310 CDD:197706 10/62 (16%)
Ig 327..419 CDD:299845 17/97 (18%)
IG_like 343..420 CDD:214653 12/76 (16%)
olfml2baNP_001038314.1 PHA03255 450..>584 CDD:165513 20/102 (20%)
OLF 625..875 CDD:280371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.