DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and lrit1a

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001018174.2 Gene:lrit1a / 553943 ZFINID:ZDB-GENE-040924-5 Length:643 Species:Danio rerio


Alignment Length:449 Identity:97/449 - (21%)
Similarity:155/449 - (34%) Gaps:162/449 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LEDIRED-TVVNAIPEK---DLP--KFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQT 170
            ||::|.| ..:::.|.:   |:|  :..::..|....:..||.       |....|.:|.:.:..
Zfish   109 LEELRLDGNSLSSFPWESLMDMPSLRLLDIHNNQLSSLPSEAA-------LYMKNITYLDLSSNN 166

  Fly   171 ILTIQNHVITKNHRMSI---THAEKRAWILRIRDVKESDKGWYMC--------QINTDPMKSQVG 224
            :||:...|:  |..::|   ..||....||.:.     |..| :|        |....|..| |.
Zfish   167 LLTVPAEVL--NTWLTIKPTLGAESSKLILGLH-----DNPW-LCDCRLYDLVQFQKSPSLS-VA 222

  Fly   225 YLDV---VVPPDILDYPTSTDMVIRE-----------------GSNVTLKCAATGSPTPTITWRR 269
            ::|.   ...|:.|.....:|..:|.                 |:||.|:|...|.|.|.:.|||
Zfish   223 FIDTRLRCADPESLSGVLFSDAELRRCQGPRVHTAVARVRSAVGNNVLLRCGTVGVPIPELAWRR 287

  Fly   270 EGGE----LIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASN--GIPPTVSKRVMLIVHFPP 328
            ..|:    .:.|.|..|.:.:  |.|::..|:..:.|.|:|.|:|  |....|   :.||::..|
Zfish   288 ADGKPLNGTVLLENSKEGIVW--SILSVPAVSYRDTGKYICKATNYAGSAEAV---ISLIINDAP 347

  Fly   329 MIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTIYE 393
            .:            :|.||:.:.:...|..|..:|                              
Zfish   348 KM------------ENPTLDPKPKLKSKKPNTMVK------------------------------ 370

  Fly   394 VDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQN 458
                                 .|.:..||     .|.::||.. |.:|:            |...
Zfish   371 ---------------------AAYQEKHI-----ATYVSPTPK-NGLPL------------SGTV 396

  Fly   459 SNTNPYNFNPGNSQQNTKLQRGKSNSKGSDQ--SPSG-----LNNVFVGATSSLWNSQD 510
            |.|.||   ||....|.      :||:.:.|  ||.|     |:|: ...||||....|
Zfish   397 SYTGPY---PGMESDNA------ANSRMNTQTASPDGFLETNLSNL-AANTSSLQQDPD 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 23/106 (22%)
IG_like 137..230 CDD:214653 23/106 (22%)
IG_like 240..324 CDD:214653 28/106 (26%)
IGc2 247..310 CDD:197706 22/83 (27%)
Ig 327..419 CDD:299845 8/91 (9%)
IG_like 343..420 CDD:214653 7/76 (9%)
lrit1aNP_001018174.2 leucine-rich repeat 61..84 CDD:275378
LRR_8 63..119 CDD:290566 4/9 (44%)
LRR_RI <77..175 CDD:238064 15/72 (21%)
leucine-rich repeat 85..108 CDD:275378
LRR_8 108..167 CDD:290566 13/64 (20%)
leucine-rich repeat 109..132 CDD:275378 6/22 (27%)
leucine-rich repeat 133..156 CDD:275378 4/29 (14%)
leucine-rich repeat 157..170 CDD:275378 3/12 (25%)
LRRCT 199..243 CDD:214507 9/45 (20%)
I-set 252..343 CDD:254352 26/95 (27%)
Ig 259..333 CDD:299845 23/75 (31%)
fn3 448..515 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.