DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and KIRREL1

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:354 Identity:96/354 - (27%)
Similarity:150/354 - (42%) Gaps:65/354 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ELLEDIREDTVVN--AIPEKDLPKFGELL----QNVTVPVSREAVLQCVVDNLQTYKIAWLRVDT 168
            |||:|.:.:|.|:  .|...|| ..|.:.    .|..:|..:|..::..|.:..|          
Human   171 ELLKDGKRETTVSQLLINPTDL-DIGRVFTCRSMNEAIPSGKETSIELDVHHPPT---------- 224

  Fly   169 QTILTIQNHVITKNHRMSIT-HAEKRAWILRIRDVK------ESDKGWYMCQIN----TDPMK-- 220
             ..|:|:...:.:..|:..| .|.....||..|..|      ::.:..|...::    |:|:.  
Human   225 -VTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCE 288

  Fly   221 --SQVGYLDV-------VVPPDILD-YPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGGELI 275
              ::||..:|       ..|..::| .||:||:    ||:|||.|...|:|..|:||.::...:.
Human   289 VHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDI----GSDVTLTCVWVGNPPLTLTWTKKDSNMG 349

  Fly   276 PLPNGA--EA-----VAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTV---SKRVMLIVHFPPMI 330
            |.|.|:  ||     |..|.:.|.:..|.:.:.|.|.|.|   |.|.:   .:.|.|.|:.||: 
Human   350 PRPPGSPPEAALSAQVLSNSNQLLLKSVTQADAGTYTCRA---IVPRIGVAEREVPLYVNGPPI- 410

  Fly   331 WIQNQLVGAALT-QNITLEC--QSEAYPKSINY-WMKNDTIIVPGERFVPETFESGYKITMRLTI 391
             |.::.|..|:. ....:||  .|...|..|.: |.:|...:...||:..|...||..:...|||
Human   411 -ISSEAVQYAVRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTI 474

  Fly   392 YEVDIQDFGA-YRCVAKNSLGDTDGAIKL 419
            ..|...||.. |.|.|.||.|.....|:|
Human   475 NNVMEADFQTHYNCTAWNSFGPGTAIIQL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 20/114 (18%)
IG_like 137..230 CDD:214653 20/114 (18%)
IG_like 240..324 CDD:214653 30/93 (32%)
IGc2 247..310 CDD:197706 24/69 (35%)
Ig 327..419 CDD:299845 30/96 (31%)
IG_like 343..420 CDD:214653 26/81 (32%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352
Ig 25..116 CDD:299845
Ig2_KIRREL3-like 138..219 CDD:143236 13/48 (27%)
I-set 223..304 CDD:254352 16/91 (18%)
Ig_2 227..305 CDD:290606 15/77 (19%)
Ig_2 311..405 CDD:290606 33/100 (33%)
IG_like 314..405 CDD:214653 32/97 (33%)
Ig5_KIRREL3 407..504 CDD:143306 31/99 (31%)
IG_like 416..504 CDD:214653 28/88 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.