DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and iglon5

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:294 Identity:87/294 - (29%)
Similarity:143/294 - (48%) Gaps:26/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 KFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAW 195
            :||.|..|:||......||:|.:|...|:| |||  :...||.......:.:.|:|:.:.....:
Zfish    28 EFGHLPDNITVLEGESVVLRCKIDEEVTHK-AWL--NRSNILFTGTDKWSLDSRVSLENNNNSDF 89

  Fly   196 ILRIRDVKESDKGWYMC--QINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAAT 258
            .:||..|..:|:|.|.|  |....|..:.| ||.|.||..|::  .|.|..:.||.:|.|.|.|.
Zfish    90 SIRIERVMVADEGPYTCSFQARNKPRTAHV-YLIVQVPARIVN--ISQDKSVNEGEDVNLFCLAV 151

  Fly   259 GSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLI 323
            |.|.|||||:          :....:...|.||.|.::.|.....:.||.:||:.|..:::|.:.
Zfish   152 GRPEPTITWK----------DFKYGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVT 206

  Fly   324 VHFPPMIW-IQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITM 387
            |::||:|. ::|  :.|.:.:...|.|::.|.|.:...|.::|...|..:    .|.:...:.|.
Zfish   207 VNYPPIITDVKN--MPAQVGKTAILRCEAMAVPTASFEWYRDDRRPVESD----NTLKIKNEKTR 265

  Fly   388 RLTIY-EVDIQDFGAYRCVAKNSLGDTDGAIKLY 420
            .|.:: .|..:.||.|.|.|.|.||.::.::.|:
Zfish   266 SLLLFTNVTEKHFGNYTCFASNRLGASNASMLLF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 29/94 (31%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 2/3 (67%)
Ig strand E 195..199 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 2/6 (33%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 27/91 (30%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 3/3 (100%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 1/4 (25%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 21/82 (26%)
iglon5NP_001017775.2 Ig 35..123 CDD:472250 28/91 (31%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 2/4 (50%)
Ig strand E 89..93 CDD:409353 0/3 (0%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 0/2 (0%)
Ig 122..207 CDD:472250 30/96 (31%)
Ig strand B 144..148 CDD:409353 2/3 (67%)
Ig strand C 157..161 CDD:409353 3/3 (100%)
Ig strand E 172..176 CDD:409353 2/3 (67%)
Ig strand F 186..191 CDD:409353 1/4 (25%)
Ig strand G 200..203 CDD:409353 0/2 (0%)
Ig_3 210..287 CDD:464046 21/82 (26%)

Return to query results.
Submit another query.