DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and OPCML

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:308 Identity:97/308 - (31%)
Similarity:154/308 - (50%) Gaps:36/308 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWI 196
            |.:.:.||||.....|.|:|.:|:..| ::|||  :..|||...|...:.:.|:.|.......:.
Human    38 FPKAMDNVTVRQGESATLRCTIDDRVT-RVAWL--NRSTILYAGNDKWSIDPRVIILVNTPTQYS 99

  Fly   197 LRIRDVKESDKGWYMCQINTD--PMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATG 259
            :.|::|...|:|.|.|.:.||  |..|:| :|.|.|||.|::  .|:|:.:.|||:|||.|.|.|
Human   100 IMIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVPPQIMN--ISSDITVNEGSSVTLLCLAIG 161

  Fly   260 SPTPTITWR----REGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRV 320
            .|.||:|||    :||          :.......:|.|:.:.|...|.|.|.|.|.:.....::|
Human   162 RPEPTVTWRHLSVKEG----------QGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKV 216

  Fly   321 MLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKI 385
            .:.|::||.| .:.:..|.::.|...|.|::.|.|.:...|.|.:|.:..|        ..|.:|
Human   217 KITVNYPPYI-SKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATG--------LDGMRI 272

  Fly   386 TMR-----LTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTM 428
            ..:     ||.:.|..:|:|.|.|||.|.||:|:.:|.||.|..::.:
Human   273 ENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEISPSSAV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 31/94 (33%)
IG_like 137..230 CDD:214653 31/94 (33%)
IG_like 240..324 CDD:214653 28/87 (32%)
IGc2 247..310 CDD:197706 24/66 (36%)
Ig 327..419 CDD:299845 29/96 (30%)
IG_like 343..420 CDD:214653 25/81 (31%)
OPCMLNP_001306032.1 Ig 44..132 CDD:416386 30/91 (33%)
Ig strand A' 44..49 CDD:409353 4/4 (100%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 1/3 (33%)
FR2 64..70 CDD:409353 4/8 (50%)
Ig strand C 64..70 CDD:409353 4/8 (50%)
CDR2 71..83 CDD:409353 4/11 (36%)
Ig strand C' 72..76 CDD:409353 2/3 (67%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 8/33 (24%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 2/3 (67%)
Ig strand G 123..132 CDD:409353 4/9 (44%)
FR4 125..132 CDD:409353 3/7 (43%)
Ig_3 135..206 CDD:404760 29/82 (35%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 5/8 (63%)
Ig strand C 165..170 CDD:409353 3/4 (75%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig 224..312 CDD:416386 28/96 (29%)
putative Ig strand A 224..230 CDD:409353 2/6 (33%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10656
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55663
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 1 0.900 - - OOG6_104123
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3058
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.