DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and NCAM2

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:695 Identity:149/695 - (21%)
Similarity:236/695 - (33%) Gaps:191/695 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RRQRRRAAGKLQRKREMPEISSRLIVATATAAVVS-----------IICLSLALPGCAAQESDDE 71
            |.|...|.|:.|....:.||..:|    ....|||           ::|...:.|..|.      
Human   117 RCQATDAKGQTQEATVVLEIYQKL----TFREVVSPQEFKQGEDAEVVCRVSSSPAPAV------ 171

  Fly    72 GELHHLDQM------------HHQHQDFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVNAI 124
            ..|:|.:::            ::..|...|.:|:|..:......|.:.:.:..:.|   .:||..
Human   172 SWLYHNEEVTTISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDII---VIVNVP 233

  Fly   125 PEKDLPK--FGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSI 187
            |...:|:  |     |.|.....|....|.........|:|.|         ...:|.:|.:..:
Human   234 PAISMPQKSF-----NATAERGEEMTFSCRASGSPEPAISWFR---------NGKLIEENEKYIL 284

  Fly   188 THAEKRAWILRIRDVKESDKGWYMCQ-INTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNV 251
            ..:...   |.:|::..||.|.|:|: .|......:..:|.|.|.|.|:.....|..   |...|
Human   285 KGSNTE---LTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFVQPHIIQLKNETTY---ENGQV 343

  Fly   252 TLKCAATGSPTPTITWRR--------EGGELIPLPNGAEAVAYNG-SFLTIAKVNRLNMGAYLCI 307
            ||.|.|.|.|.|.|||:|        ||.:  .|....|....:| |.|.|..|...:.|.|.|.
Human   344 TLVCDAEGEPIPEITWKRAVDGFTFTEGDK--SLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCE 406

  Fly   308 ASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQN-ITLECQSEAYPKSINYWMKNDTIIVPG 371
            |::.|... .|.:.|.:.:.|. :|.||.:..:...| |.:.|..::.|.:..:| :.|.:::|.
Human   407 AASRIGGH-QKSMYLDIEYAPK-FISNQTIYYSWEGNPINISCDVKSNPPASIHW-RRDKLVLPA 468

  Fly   372 ERFVP-ETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLG--------------DTDGAIKLYH 421
            :.... :|:.:|.|  |.|.|......|||.|.|.|.|.:|              .:...:|:..
Human   469 KNTTNLKTYSTGRK--MILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIE 531

  Fly   422 IPQTTTMTTMAPTVSINTVPV----VLVK------YNKEQRYGSSQNSNTNPYNFNPGNSQQNT- 475
            :.|||...:.....|...||:    |.||      :...:.:|.......|       |.:.|| 
Human   532 LSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLN-------NLEPNTT 589

  Fly   476 -KLQRGKSNSKGS---------------DQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSR 524
             :::....|.||.               :.||..::.               ..||..|...|..
Human   590 YEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHG---------------QPSSGKSFKLSIT 639

  Fly   525 GRDHHQQQHHQQQQQNHGSDHGA-------SYRSDGKSPHLTNHDAKSLTDD--LDRMQDLKGW- 579
            .:|                |.||       .|||..|.........:...|.  |:.:|...|: 
Human   640 KQD----------------DGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYE 688

  Fly   580 -----ASRLSPISPI--------------------LGLSMILGVG 599
                 |:||....|.                    |||..::|:|
Human   689 VQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAVIGLG 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 19/93 (20%)
Ig strand B 147..151 CDD:409353 0/3 (0%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 2/5 (40%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 32/100 (32%)
Ig strand B 251..255 CDD:409275 3/3 (100%)
Ig strand C 264..268 CDD:409275 2/3 (67%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 23/82 (28%)
NCAM2XP_011527877.1 IgI_1_NCAM-2 46..138 CDD:409452 7/20 (35%)
Ig strand A 46..51 CDD:409452
Ig strand A' 54..58 CDD:409452
Ig strand B 60..70 CDD:409452
Ig strand C 74..80 CDD:409452
Ig strand C' 83..85 CDD:409452
Ig strand D 91..97 CDD:409452
Ig strand E 99..107 CDD:409452
Ig strand F 114..121 CDD:409452 2/3 (67%)
Ig strand G 126..137 CDD:409452 2/10 (20%)
Ig 142..218 CDD:472250 13/81 (16%)
Ig strand C 170..174 CDD:409353 1/9 (11%)
Ig strand E 193..197 CDD:409353 0/3 (0%)
IgI_1_MuSK 234..323 CDD:409562 21/105 (20%)
Ig strand A 234..237 CDD:409562 1/2 (50%)
Ig strand A' 242..247 CDD:409562 2/9 (22%)
Ig strand B 253..260 CDD:409562 1/6 (17%)
Ig strand C 266..271 CDD:409562 2/4 (50%)
Ig strand C' 273..275 CDD:409562 0/1 (0%)
Ig strand D 282..285 CDD:409562 0/2 (0%)
Ig strand E 289..295 CDD:409562 1/8 (13%)
Ig strand F 302..309 CDD:409562 3/6 (50%)
Ig strand G 315..323 CDD:409562 1/7 (14%)
IgI_NCAM-2 325..422 CDD:143278 33/102 (32%)
Ig strand A 325..330 CDD:143278 2/4 (50%)
Ig strand A' 334..338 CDD:143278 1/3 (33%)
Ig strand B 342..350 CDD:143278 4/7 (57%)
Ig strand C 356..362 CDD:143278 3/5 (60%)
Ig strand C' 365..368 CDD:143278 0/2 (0%)
Ig strand D 378..384 CDD:143278 1/5 (20%)
Ig strand E 387..393 CDD:143278 2/5 (40%)
Ig strand F 401..409 CDD:143278 4/7 (57%)
Ig strand G 412..422 CDD:143278 2/10 (20%)
Ig_3 426..504 CDD:464046 23/81 (28%)
FN3 521..613 CDD:238020 18/98 (18%)
fn3 619..703 CDD:394996 21/114 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.