DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and DIP-gamma

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:319 Identity:137/319 - (42%)
Similarity:188/319 - (58%) Gaps:26/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRA 194
            |:|...:.|||.|..|||:|.|.|.||...|:.|||...||:|.:|..|:|.|.|:|:.|.:...
  Fly    39 PEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHT 103

  Fly   195 WILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATG 259
            |.|:|..::|||:|.|||||||.|||.|||.:||.|||||::..:|.|:.::||.:.||.|.|||
  Fly   104 WKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATG 168

  Fly   260 SPTPTITWRREGGELIPL--PNGAEAV---AYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKR 319
            :|.|.:|||||.||:|.:  |...|.:   :||||.|.:.::.|..||||||||||.:||.||||
  Fly   169 NPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKR 233

  Fly   320 VMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMK--------------------- 363
            |.|.|.|.||:...:||:|..|..::.||||.||.|..::||:|                     
  Fly   234 VSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSP 298

  Fly   364 NDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHI 422
            ...:::.|.::.......||:..|.|.:......|.|.|.||:.||||..:|.::||.|
  Fly   299 GPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 48/92 (52%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 3/4 (75%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 49/96 (51%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 4/4 (100%)
Ig strand G 317..320 CDD:409275 2/2 (100%)
Ig_3 327..408 CDD:464046 26/101 (26%)
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 41/81 (51%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 3/4 (75%)
Ig 141..238 CDD:472250 49/96 (51%)
Ig strand B 160..164 CDD:409562 2/3 (67%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 4/4 (100%)
Ig strand G 231..234 CDD:409562 2/2 (100%)
IG_like 247..355 CDD:214653 29/107 (27%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 1/3 (33%)
Ig strand E 317..326 CDD:409358 4/8 (50%)
Ig strand F 336..341 CDD:409358 2/4 (50%)

Return to query results.
Submit another query.