DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr15

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:417 Identity:84/417 - (20%)
Similarity:126/417 - (30%) Gaps:139/417 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 QNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTI-QNHVITKNHRMSITHAEKRAWILRIR 200
            |.:.......|.|.|.|..|....|:|||:....|||: |...|......|:.......|.|:|:
  Fly   197 QTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIK 261

  Fly   201 DVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMV------IREGSNVTLKCAATG 259
            .|:..|:|.|.||::|:|..|.:.:|.:|.|        .|:::      ::.||.|.|:|..:.
  Fly   262 YVQLKDEGTYECQVSTEPKASAIVHLRIVEP--------KTELIGESTRHVKAGSQVKLRCIISQ 318

  Fly   260 SPTPTI-----------------TWRREGGELIPLP----------------------------- 278
            :..|.:                 .||.| .|.|.||                             
  Fly   319 ALEPPLFINWFYNQKQIYLHNRRGWRTE-IERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPA 382

  Fly   279 ----------NGAEAVAYNGSFLTIAK-----------VNRLNMGAYLCIASNGIPPTVSKRVML 322
                      .||.:.......:||.:           |:.|...|.:.:|      |.:....|
  Fly   383 TPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVA------TETSTAQL 441

  Fly   323 IVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITM 387
            :..............||.|     |...|.||....   ....|....|:........|.:..||
  Fly   442 LTEVEATSSTSGTSTGAGL-----LASTSAAYAAGA---AAGITTAATGDSAATAATTSAWLTTM 498

  Fly   388 RLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVS----INTVPVVLVKYN 448
                                    |.:.|     ....||.|||.|:.|    |.|..:::....
  Fly   499 ------------------------DAEAA-----TTAATTTTTMLPSSSFIKQITTASLIIPAVV 534

  Fly   449 KEQRYGSSQNSNTNPYNFNPGNSQQNT 475
            |         .::..|..:|.||...|
  Fly   535 K---------LDSGNYTCSPSNSAPRT 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 29/93 (31%)
IG_like 137..230 CDD:214653 29/93 (31%)
IG_like 240..324 CDD:214653 24/156 (15%)
IGc2 247..310 CDD:197706 21/129 (16%)
Ig 327..419 CDD:299845 14/91 (15%)
IG_like 343..420 CDD:214653 11/76 (14%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 29/91 (32%)
V-set 204..290 CDD:284989 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.