DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr5

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:296 Identity:70/296 - (23%)
Similarity:117/296 - (39%) Gaps:54/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GKLQRKREMPEISSRLIVATATAAVVSIICLSLALPGCAAQESDDEGELHHLDQMHHQHQDFIIG 90
            ||:......|:|:..::|....|.   ::.:.|..|               :|:           
  Fly    24 GKVISNSRAPQIAHEMLVEYFMAL---LVIMGLTAP---------------VDK----------- 59

  Fly    91 ESEEHDHIAHHLAEMQNKDELLEDIRE--DTVVNAIPEKDLPKFGELLQNVTVPVSREAVLQCVV 153
            :|........|||..:....|:.|..:  |.|.:...:::          |...:...|.|.|.|
  Fly    60 QSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDRE----------VIAALGTTARLHCRV 114

  Fly   154 DNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKR-AWILRIRDVKESDKGWYMCQINTD 217
            .:|....::|:|.....||||.....|.:.|....|.:.. .|:|:|..|::.|.|.|.||::|:
  Fly   115 RHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTE 179

  Fly   218 PMKSQVGYLDVVV--PPDILDYPTSTDMVIREGSNVTLKCAATGSPTP--TITWRREGGELIPLP 278
            | |..:.|..|||  ...||   .:.::.|:.||::.|.|.|..:|.|  .:.|.::...:....
  Fly   180 P-KISLAYKLVVVTSKAQIL---ANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSA 240

  Fly   279 NGAEAV----AYNGSFLTIAKVNRLNMGAYLCIASN 310
            .|...|    ....|.|.|::|...:.|.|.|.|.|
  Fly   241 RGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 29/93 (31%)
IG_like 137..230 CDD:214653 29/93 (31%)
IG_like 240..324 CDD:214653 20/77 (26%)
IGc2 247..310 CDD:197706 18/68 (26%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
dpr5NP_650080.3 V-set 95..191 CDD:284989 29/106 (27%)
IG_like 98..179 CDD:214653 24/90 (27%)
IG_like 206..278 CDD:214653 19/71 (27%)
Ig 211..278 CDD:143165 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.