DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr11

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:397 Identity:97/397 - (24%)
Similarity:148/397 - (37%) Gaps:92/397 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLQRKREMPEISSR---LIVATATAAVV-SIICLSLAL---------------PGCAAQE----- 67
            |.:.:.||..:.:|   |..|..|..:: .|:||::|.               ||....|     
  Fly     5 KNRSRSEMQTLETRVRPLQGAQLTQLLLGGILCLTIASHTQTSAEAAGGRVSGPGAGTSEGAGTS 69

  Fly    68 ----------SDDEGELHHLDQMHHQHQDFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVN 122
                      ||:.|:                      ...|...:.:.....||.:....:..:
  Fly    70 SASAASTAISSDESGD----------------------PSSATAFSSLAQVSSLLPEASALSATS 112

  Fly   123 AIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSI 187
            .:.|..|.  |....|||..:...|.|.|.|..|....::|:|:....|||:...|...:.|...
  Fly   113 GLVEPYLD--GYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLA 175

  Fly   188 THAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVP-PDILDYPTSTDMVIREGSNV 251
            .....:.|.|:|:.|:..|.|.|.||::|:|..|....|.|||| .:||..|   |..::.||||
  Fly   176 IKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEP---DRYVKAGSNV 237

  Fly   252 TLKCAATGS--PTPTITW-----------RREGGELIP-LPNGA-EAVAYNGSFLTIAKVNRLNM 301
            .|:|...|:  |...|.|           ||...:|.| ||..: |..:..|| |.|....:.:.
  Fly   238 VLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGS-LIIESAKKRDT 301

  Fly   302 GAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDT 366
            |.|.|..||....||:..:           |..:...:|:|.:   ...:.||..||...:.:..
  Fly   302 GNYTCSPSNSPSATVTLNI-----------INGESSASAVTSS---AATTRAYALSILALLLSVI 352

  Fly   367 IIVPGER 373
            :|..|.|
  Fly   353 LIGVGHR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 29/92 (32%)
IG_like 137..230 CDD:214653 29/92 (32%)
IG_like 240..324 CDD:214653 29/98 (30%)
IGc2 247..310 CDD:197706 24/77 (31%)
Ig 327..419 CDD:299845 10/47 (21%)
IG_like 343..420 CDD:214653 7/31 (23%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 28/90 (31%)
Ig 127..217 CDD:299845 27/89 (30%)
IG_like 227..320 CDD:214653 30/96 (31%)
IGc2 234..311 CDD:197706 25/77 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.