DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr11

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:397 Identity:97/397 - (24%)
Similarity:148/397 - (37%) Gaps:92/397 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLQRKREMPEISSR---LIVATATAAVV-SIICLSLAL---------------PGCAAQE----- 67
            |.:.:.||..:.:|   |..|..|..:: .|:||::|.               ||....|     
  Fly     5 KNRSRSEMQTLETRVRPLQGAQLTQLLLGGILCLTIASHTQTSAEAAGGRVSGPGAGTSEGAGTS 69

  Fly    68 ----------SDDEGELHHLDQMHHQHQDFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVN 122
                      ||:.|:                      ...|...:.:.....||.:....:..:
  Fly    70 SASAASTAISSDESGD----------------------PSSATAFSSLAQVSSLLPEASALSATS 112

  Fly   123 AIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSI 187
            .:.|..|.  |....|||..:...|.|.|.|..|....::|:|:....|||:...|...:.|...
  Fly   113 GLVEPYLD--GYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLA 175

  Fly   188 THAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVP-PDILDYPTSTDMVIREGSNV 251
            .....:.|.|:|:.|:..|.|.|.||::|:|..|....|.|||| .:||..|   |..::.||||
  Fly   176 IKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEP---DRYVKAGSNV 237

  Fly   252 TLKCAATGS--PTPTITW-----------RREGGELIP-LPNGA-EAVAYNGSFLTIAKVNRLNM 301
            .|:|...|:  |...|.|           ||...:|.| ||..: |..:..|| |.|....:.:.
  Fly   238 VLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGS-LIIESAKKRDT 301

  Fly   302 GAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDT 366
            |.|.|..||....||:..:           |..:...:|:|.:   ...:.||..||...:.:..
  Fly   302 GNYTCSPSNSPSATVTLNI-----------INGESSASAVTSS---AATTRAYALSILALLLSVI 352

  Fly   367 IIVPGER 373
            :|..|.|
  Fly   353 LIGVGHR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 29/92 (32%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 32/106 (30%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 2/14 (14%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 10/47 (21%)
dpr11NP_788586.1 Ig 125..216 CDD:472250 28/90 (31%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 30/96 (31%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 3/4 (75%)
Ig strand G 313..316 CDD:409544 0/2 (0%)

Return to query results.
Submit another query.