DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and IGLON5

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens


Alignment Length:351 Identity:101/351 - (28%)
Similarity:146/351 - (41%) Gaps:75/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 KFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAW 195
            :|.....|.||.....|.|.|.:|...| ::|||  :...||...|...|.:.|:.:.......:
Human    34 EFNSPADNYTVCEGDNATLSCFIDEHVT-RVAWL--NRSNILYAGNDRWTSDPRVRLLINTPEEF 95

  Fly   196 ILRIRDVKESDKGWYMCQINT--DPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAAT 258
            .:.|.:|...|:|.|.|...|  .|..:|| ||.|.||..|::  .|:.:.:.||.||.|.|.|.
Human    96 SILITEVGLGDEGLYTCSFQTRHQPYTTQV-YLIVHVPARIVN--ISSPVTVNEGGNVNLLCLAV 157

  Fly   259 GSPTPTITWR--REGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTV-SKRV 320
            |.|.||:|||  |:|            ....|..|.|:.:.|...|.|.|:..||:.... |:||
Human   158 GRPEPTVTWRQLRDG------------FTSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRV 210

  Fly   321 MLIVHFPPMIWIQNQLVGA--ALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGY 383
            ::.|::||.|   ..:..|  ||.:...|.|::.|.|.:...|.|:|.::..|      |.| |.
Human   211 LVTVNYPPTI---TDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLSSG------TAE-GL 265

  Fly   384 KI-TMR----LTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVPVV 443
            |: |.|    |....|..:.:|.|.|.|.|.||.:..:::|.                       
Human   266 KVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRLL----------------------- 307

  Fly   444 LVKYNKEQRYGSSQNSNTNPYNFNPG 469
                    |.||.:||...|    ||
Human   308 --------RPGSLENSAPRP----PG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 29/94 (31%)
IG_like 137..230 CDD:214653 29/94 (31%)
IG_like 240..324 CDD:214653 29/86 (34%)
IGc2 247..310 CDD:197706 23/64 (36%)
Ig 327..419 CDD:299845 29/98 (30%)
IG_like 343..420 CDD:214653 23/81 (28%)
IGLON5NP_001094842.1 Ig 41..129 CDD:416386 28/91 (31%)
Ig strand A' 41..46 CDD:409353 3/4 (75%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 1/3 (33%)
FR2 61..68 CDD:409353 4/9 (44%)
Ig strand C 61..67 CDD:409353 4/8 (50%)
CDR2 69..79 CDD:409353 3/9 (33%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 8/34 (24%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 5/9 (56%)
FR4 122..129 CDD:409353 4/7 (57%)
Ig_3 134..199 CDD:404760 25/78 (32%)
Ig strand B 148..157 CDD:409353 4/8 (50%)
Ig strand C 162..170 CDD:409353 5/7 (71%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig strand G 202..212 CDD:409353 3/9 (33%)
Ig_3 217..295 CDD:404760 26/87 (30%)
putative Ig strand A 218..224 CDD:409353 2/8 (25%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10656
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.