DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and TMIGD1

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_996663.1 Gene:TMIGD1 / 388364 HGNCID:32431 Length:262 Species:Homo sapiens


Alignment Length:179 Identity:50/179 - (27%)
Similarity:79/179 - (44%) Gaps:40/179 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 GSNVTLKCAATG-SPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIAS-- 309
            ||..:|.||... :....:.|.||.|. :.|.:|                |::|..: :|::|  
Human    47 GSQASLICAVQNHTREEELLWYREEGR-VDLKSG----------------NKINSSS-VCVSSIS 93

  Fly   310 ---NGIPPT--------VSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMK 363
               |||..|        ||..|:|.|.|||:: ..|.........|:.|.|..:|.|::...|.|
Human    94 ENDNGISFTCRLGRDQSVSVSVVLNVTFPPLL-SGNDFQTVEEGSNVKLVCNVKANPQAQMMWYK 157

  Fly   364 NDTI--IVPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSL 410
            |.::  :......:.:|.||     .:|:|.:|:..|.|.|.|:||:||
Human   158 NSSLLDLEKSRHQIQQTSES-----FQLSITKVEKPDNGTYSCIAKSSL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845
IG_like 137..230 CDD:214653
IG_like 240..324 CDD:214653 23/89 (26%)
IGc2 247..310 CDD:197706 15/67 (22%)
Ig 327..419 CDD:299845 25/86 (29%)
IG_like 343..420 CDD:214653 22/70 (31%)
TMIGD1NP_996663.1 IG 131..212 CDD:214652 22/76 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11661
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.