DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dscamb

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_009289749.1 Gene:dscamb / 386937 ZFINID:ZDB-GENE-031118-67 Length:2020 Species:Danio rerio


Alignment Length:571 Identity:124/571 - (21%)
Similarity:198/571 - (34%) Gaps:156/571 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIR 200
            ::|||....|:..:.|.:.....|.|.|.:         .::::..|||.   .|.:....|::.
Zfish   510 MKNVTAIAGRDTYIHCRIIGYPYYSIKWYK---------DSNLLPFNHRQ---RAFENNGTLKLS 562

  Fly   201 DVKESDKGWYMCQINTDPMKS--QVGYLDVVVPP------------------------------- 232
            :|:.||:|.|.|.:..||.|.  :..::.|.|||                               
Zfish   563 NVQNSDEGEYTCYVLVDPEKQIHRSVHVTVKVPPLIQHSDSQSASIGQRVFIPCVVISGDLPMSI 627

  Fly   233 -----------------DILDYPT----------------------------STDMVIR------ 246
                             |.:|:.:                            |..::::      
Zfish   628 TWHKDGRPINASLGVTIDNIDFTSSLRISNLSEIHNGSYTCIARNEAAAVEHSIQLIVKVPPHFE 692

  Fly   247 ---------EGSNVTLKCAATGSPTPTITWRREGGELIP------LPNGAEA-VAYNGSFLTIAK 295
                     .|.:|||.|:|.|:|.|||.|....|..:|      |.:|:.. :..|||.| |..
Zfish   693 VQPKDQDGIYGKSVTLNCSAKGNPIPTIVWNHSKGAGVPQFQPIALNSGSRVQLLENGSLL-IKH 756

  Fly   296 VNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINY 360
            |...:.|.|||..||.:...:||.:.|.|..|.||........|.......:.|.:.........
Zfish   757 VLEEDAGFYLCKVSNDVGADISKSMYLTVKIPAMITSYPNTTRAEQGHMTEMSCTAHGEKPIKVR 821

  Fly   361 WMKNDTIIVPG-ERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQ 424
            |.|...||.|. .|:|....|.|.::...|.|.....:|.|.:.|:|.||.|:..|.|:|  |.|
Zfish   822 WEKESHIINPDMSRYVVTVKEVGDEVISTLQILHTVREDSGFFSCIAINSYGEDKGIIQL--IVQ 884

  Fly   425 TTTMTTMAPTVSINTVP--VVLVKYNKEQRYGSSQNSNTNPYNFNPGNSQQN-TKLQRGKSNSKG 486
            .   ....|.|.|..|.  .:.:::.    .|...||....|:.|..|...: ...|..|..|..
Zfish   885 D---RPDPPEVEIREVKDRTIALRWT----MGFDGNSPITGYDINYKNKSASWASSQMTKDVSPQ 942

  Fly   487 SDQS------PSGLNNVFVGATSSLWNSQDHHSSSSSSSSA--------------SSRGRDHHQQ 531
            .:|:      |:...|:.:.|.:.:..|:..:..:.::..|              ||:|.....:
Zfish   943 LNQATIIELHPASTYNIRMFAKNQIGESRPSNELTITTDEAPPDGAPQDVQLEAISSQGIKVTWK 1007

  Fly   532 QHHQQQQQNHGSDHGASYR--SDGKSPHL------TNHDAKSLTDDLDRMQ 574
            ..|:..|......:...||  ..|.||..      |..|.::||  ||.::
Zfish  1008 PPHKHLQNGLIRSYQVCYREFGTGGSPQYNTINVDTTGDIETLT--LDNLK 1056

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 23/94 (24%)
Ig strand B 147..151 CDD:409353 0/3 (0%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/4 (0%)
Ig 232..324 CDD:472250 35/189 (19%)
Ig strand B 251..255 CDD:409275 3/3 (100%)
Ig strand C 264..268 CDD:409275 2/3 (67%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 3/4 (75%)
Ig strand G 317..320 CDD:409275 2/2 (100%)
Ig_3 327..408 CDD:464046 20/81 (25%)
dscambXP_009289749.1 Ig 26..121 CDD:472250
Ig strand B 42..46 CDD:409353
Ig strand C 55..59 CDD:409353
Ig strand E 79..83 CDD:409353
Ig strand F 99..104 CDD:409353
Ig strand G 112..116 CDD:409353
Ig 125..217 CDD:472250
Ig strand B 141..145 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 194..199 CDD:409353
Ig strand G 209..213 CDD:409353
Ig 225..310 CDD:472250
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand E 276..280 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..389 CDD:472250
Ig strand B 331..335 CDD:409353
Ig strand C 344..348 CDD:409353
Ig strand E 368..372 CDD:409353
Ig strand F 382..387 CDD:409353
Ig 406..501 CDD:472250
Ig strand B 424..428 CDD:409353
Ig strand C 437..441 CDD:409353
Ig strand E 467..471 CDD:409353
Ig strand F 481..486 CDD:409353
Ig strand G 494..497 CDD:409353
Ig 504..592 CDD:472250 22/93 (24%)
Ig strand B 521..525 CDD:409353 0/3 (0%)
Ig strand C 534..538 CDD:409353 1/3 (33%)
Ig strand E 557..561 CDD:409353 1/3 (33%)
Ig strand F 571..576 CDD:409353 2/4 (50%)
Ig strand G 585..588 CDD:409353 0/2 (0%)
Ig 595..685 CDD:472250 5/89 (6%)
Ig strand B 612..616 CDD:409353 0/3 (0%)
Ig strand C 626..630 CDD:409353 0/3 (0%)
Ig strand E 651..655 CDD:409353 0/3 (0%)
Ig strand F 665..670 CDD:409353 0/4 (0%)
Ig strand G 678..681 CDD:409353 0/2 (0%)
Ig_DSCAM 688..785 CDD:409397 31/97 (32%)
putative Ig strand A 688..692 CDD:409397 0/3 (0%)
putative Ig strand A' 697..701 CDD:409397 0/3 (0%)
putative Ig strand B 703..713 CDD:409397 5/9 (56%)
putative Ig strand C 719..725 CDD:409397 3/5 (60%)
putative Ig strand C' 732..735 CDD:409397 0/2 (0%)
putative Ig strand D 745..748 CDD:409397 0/2 (0%)
putative Ig strand E 750..756 CDD:409397 4/6 (67%)
putative Ig strand F 763..771 CDD:409397 4/7 (57%)
putative Ig strand G 776..785 CDD:409397 3/8 (38%)
Ig_DSCAM 786..885 CDD:409398 27/100 (27%)
putative Ig strand A 786..789 CDD:409398 0/2 (0%)
putative Ig strand A' 797..801 CDD:409398 0/3 (0%)
putative Ig strand B 804..811 CDD:409398 0/6 (0%)
putative Ig strand C 819..825 CDD:409398 1/5 (20%)
putative Ig strand C' 834..837 CDD:409398 1/2 (50%)
putative Ig strand D 843..847 CDD:409398 1/3 (33%)
putative Ig strand E 849..855 CDD:409398 2/5 (40%)
putative Ig strand F 862..870 CDD:409398 3/7 (43%)
putative Ig strand G 873..883 CDD:409398 4/11 (36%)
FN3 887..980 CDD:238020 18/96 (19%)
FN3 <938..1306 CDD:442628 23/121 (19%)
Ig_3 1288..1364 CDD:464046
FN3 1398..1471 CDD:238020
FN3 1485..1557 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.