DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Obscn

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001415297.1 Gene:Obscn / 380698 MGIID:2681862 Length:8877 Species:Mus musculus


Alignment Length:642 Identity:122/642 - (19%)
Similarity:228/642 - (35%) Gaps:182/642 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GKLQ--RKREMPEISSRLIVATATAAVVSIICLSL------------ALPGCAAQESDDEGELHH 76
            |:||  ....|..:.....|..|.|:..::|..::            .|.||.   :||:..:..
Mouse  6646 GELQFLESHHMKHLERSPRVPAAVASQKTVIFRNVQDISHFHSSFLKELQGCG---TDDDVAMCF 6707

  Fly    77 L--DQMHHQHQDFIIGESEEHDHIA------------------------------HHLAE----M 105
            :  .:...::.:|::|..:....:.                              |:|.:    :
Mouse  6708 IKNQEAFEKYLEFLVGRVQAESVVVSTPVQEFYKKYAEETLSAKDPTQPPPPPLQHYLEQPVERV 6772

  Fly   106 QNKDELLEDI-------RED--------TVVNAIPEKDLPKFG-ELLQNVTVPVSREAVLQCVVD 154
            |....||:::       |::        .||:|:|::...|.. .|::|  .|.:.||:.:.:  
Mouse  6773 QKYQALLKELIRNKARNRQNCALLEQAYAVVSALPQRAENKLHVSLMEN--YPGTLEALGEPI-- 6833

  Fly   155 NLQTYKIAW---------LRVDTQTILTIQNH-VITKNHRMSITHAEKRAWILR---------IR 200
             .|.:.|.|         .:...:.:...:|: ||.|..|.|.|  :..:::.|         :.
Mouse  6834 -RQGHFIVWEGAPGARMPWKGHNRHVFLFRNYLVICKPRRDSRT--DTFSYVFRNMMKLSSIDLN 6895

  Fly   201 DVKESD----KGW---------YMCQINTDPMKS----------QVGYLDVVVPPDILDYPTSTD 242
            |..|.|    :.|         |:.|..|..:|:          |.....|..||:..:  ...|
Mouse  6896 DQVEGDDRAFEVWHEREDSVRKYLLQARTVIIKNSWVKEICGIQQRLAQPVWRPPEFEE--ELAD 6958

  Fly   243 MVIREGSNVTLKCAATGSPTPTITWRREGGE--------LIPLPNGAEAVAYNGSFLTIAKVNRL 299
            .....|..|.|.|..||:|.|.::|.::|..        ||..|:|:       ..|.:..:..:
Mouse  6959 CTAELGETVKLACRVTGTPKPIVSWYKDGKPVEVDPHHILIEDPDGS-------CTLILDNLTGI 7016

  Fly   300 NMGAYLCIASN--GIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWM 362
            :.|.|:|.|::  |...|:.|   ::|..||....:.:.......::..:.|..|..|.....|.
Mouse  7017 DSGQYMCFAASAAGNASTLGK---ILVQVPPRFVNKVRATPFVEGEDAQITCTVEGAPYPQIRWY 7078

  Fly   363 KNDTIIVPGERF-VPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTT 426
            |:.|::.||.|: :.....||..:   |.|.....:|.|.|.|...|.||.|.|..:||      
Mouse  7079 KDGTLLAPGNRYRMLNEPRSGVLV---LVIQAASKEDLGHYECELVNRLGSTRGGGELY------ 7134

  Fly   427 TMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNT--NPYNFNPGNSQQNTKLQRGKSNSKGSDQ 489
               ..:|.:....      ::::||...:.::::.  :.::...|..||...:......|:....
Mouse  7135 ---MQSPALRARD------QHHREQIVAAVEDTSVEGSAHSAQDGADQQAASVLWRLLGSEALGP 7190

  Fly   490 SPSGLNN-------VFVGATSSLWNSQD--------------HHSSSSSSSSASSRG 525
            ||..|.|       .|..|.|.:..:..              |......::|:.|:|
Mouse  7191 SPGDLPNTRQSEPPAFEEAASQIPGAASGTPGELPEVSQPGTHKGLEQETTSSGSQG 7247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 25/134 (19%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 2/12 (17%)
Ig strand E 195..199 CDD:409353 1/12 (8%)
Ig strand F 209..214 CDD:409353 2/13 (15%)
Ig strand G 221..224 CDD:409353 1/12 (8%)
Ig 232..324 CDD:472250 24/101 (24%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 19/81 (23%)
ObscnNP_001415297.1 I-set 9..98 CDD:400151
Ig strand B 26..30 CDD:409353
Ig strand C 39..43 CDD:409353
Ig strand E 61..65 CDD:409353
Ig strand F 78..83 CDD:409353
I-set 109..200 CDD:400151
Ig strand B 126..130 CDD:409353
Ig strand C 139..143 CDD:409353
Ig strand E 166..170 CDD:409353
Ig strand F 180..185 CDD:409353
Ig strand G 193..196 CDD:409353
I-set 246..326 CDD:400151
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
Ig 333..416 CDD:472250
Ig strand B 348..352 CDD:409353
Ig strand C 360..364 CDD:409353
Ig strand E 385..389 CDD:409353
Ig strand F 399..404 CDD:409353
Ig 422..503 CDD:472250
Ig strand B 436..440 CDD:409353
Ig strand C 448..452 CDD:409353
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
Ig strand G 496..499 CDD:409353
FN3 513..600 CDD:238020
Ig 615..>671 CDD:472250
Ig 709..789 CDD:472250
Ig strand B 722..726 CDD:409353
Ig strand C 734..738 CDD:409353
Ig strand E 759..763 CDD:409353
Ig strand F 773..778 CDD:409353
Ig strand G 782..785 CDD:409353
Ig 800..881 CDD:472250
Ig strand B 814..818 CDD:409353
Ig strand C 826..830 CDD:409353
Ig strand E 851..855 CDD:409353
Ig strand F 865..870 CDD:409353
Ig strand G 874..877 CDD:409353
Ig 892..973 CDD:472250
Ig strand B 906..910 CDD:409353
Ig strand C 918..922 CDD:409353
Ig strand E 943..947 CDD:409353
Ig strand F 957..962 CDD:409353
Ig strand G 966..969 CDD:409353
Ig 984..1065 CDD:472250
Ig strand B 998..1002 CDD:409353
Ig strand C 1010..1014 CDD:409353
Ig strand E 1035..1039 CDD:409353
Ig strand F 1049..1054 CDD:409353
Ig strand G 1058..1061 CDD:409353
Ig 1076..1157 CDD:472250
Ig strand B 1090..1094 CDD:409353
Ig strand C 1102..1106 CDD:409353
Ig strand E 1127..1131 CDD:409353
Ig strand F 1141..1146 CDD:409353
Ig strand G 1150..1153 CDD:409353
Ig 1168..1249 CDD:472250
Ig strand B 1182..1186 CDD:409353
Ig strand C 1194..1198 CDD:409353
Ig strand E 1219..1223 CDD:409353
Ig strand F 1233..1238 CDD:409353
Ig strand G 1242..1245 CDD:409353
Ig 1260..1341 CDD:472250
Ig strand B 1274..1278 CDD:409353
Ig strand C 1286..1290 CDD:409353
Ig strand E 1311..1315 CDD:409353
Ig strand F 1325..1330 CDD:409353
Ig strand G 1334..1337 CDD:409353
Ig 1352..1433 CDD:472250
Ig strand B 1366..1370 CDD:409353
Ig strand C 1378..1382 CDD:409353
Ig strand E 1403..1407 CDD:409353
Ig strand F 1417..1422 CDD:409353
Ig strand G 1426..1429 CDD:409353
Ig 1444..1525 CDD:472250
Ig strand B 1458..1462 CDD:409353
Ig strand C 1470..1474 CDD:409353
Ig strand E 1495..1499 CDD:409353
Ig strand F 1509..1514 CDD:409353
Ig strand G 1518..1521 CDD:409353
Ig 1536..1617 CDD:472250
Ig strand B 1550..1554 CDD:409353
Ig strand C 1562..1566 CDD:409353
Ig strand E 1587..1591 CDD:409353
Ig strand F 1601..1606 CDD:409353
Ig strand G 1610..1613 CDD:409353
Ig 1628..1709 CDD:472250
Ig strand B 1642..1646 CDD:409353
Ig strand C 1654..1658 CDD:409353
Ig strand E 1679..1683 CDD:409353
Ig strand F 1693..1698 CDD:409353
Ig strand G 1702..1705 CDD:409353
Ig 1720..1801 CDD:472250
Ig strand B 1734..1738 CDD:409353
Ig strand C 1746..1750 CDD:409353
Ig strand E 1771..1775 CDD:409353
Ig strand F 1785..1790 CDD:409353
Ig strand G 1794..1797 CDD:409353
Ig 1812..1893 CDD:472250
Ig strand B 1826..1830 CDD:409353
Ig strand C 1838..1842 CDD:409353
Ig strand E 1863..1867 CDD:409353
Ig strand F 1877..1882 CDD:409353
Ig strand G 1886..1889 CDD:409353
Ig 1904..1985 CDD:472250
Ig strand B 1918..1922 CDD:409353
Ig strand C 1930..1934 CDD:409353
Ig strand E 1955..1959 CDD:409353
Ig strand F 1969..1974 CDD:409353
Ig strand G 1978..1981 CDD:409353
Ig 1996..2077 CDD:472250
Ig strand B 2010..2014 CDD:409353
Ig strand C 2022..2026 CDD:409353
Ig strand E 2047..2051 CDD:409353
Ig strand F 2061..2066 CDD:409353
Ig strand G 2070..2073 CDD:409353
Ig 2093..2159 CDD:472250
Ig strand B 2102..2106 CDD:409353
Ig strand C 2115..2119 CDD:409353
Ig strand E 2140..2144 CDD:409353
Ig strand F 2154..2159 CDD:409353
Ig 2179..2259 CDD:472250
Ig strand B 2192..2196 CDD:409353
Ig strand C 2204..2208 CDD:409353
Ig strand E 2229..2233 CDD:409353
Ig strand F 2243..2248 CDD:409353
Ig strand G 2252..2255 CDD:409353
Ig 2266..2349 CDD:472250
Ig strand B 2282..2286 CDD:409353
Ig strand C 2294..2298 CDD:409353
Ig strand E 2319..2323 CDD:409353
Ig strand F 2333..2338 CDD:409353
Ig strand G 2342..2345 CDD:409353
Ig 2356..2439 CDD:472250
Ig strand B 2371..2375 CDD:409353
Ig strand C 2383..2387 CDD:409353
Ig strand E 2408..2412 CDD:409353
Ig strand F 2422..2427 CDD:409353
Ig 2533..2615 CDD:472250
Ig strand B 2549..2553 CDD:409353
Ig strand C 2560..2564 CDD:409353
Ig strand E 2585..2589 CDD:409353
Ig strand F 2599..2604 CDD:409353
Ig strand G 2608..2611 CDD:409353
Ig 2621..2704 CDD:472250
Ig strand B 2637..2641 CDD:409353
Ig strand C 2650..2653 CDD:409353
Ig strand E 2674..2678 CDD:409353
Ig strand F 2688..2693 CDD:409353
Ig 2712..2793 CDD:472250
Ig strand B 2726..2730 CDD:409353
Ig strand C 2738..2742 CDD:409353
Ig strand E 2763..2767 CDD:409353
Ig strand F 2777..2782 CDD:409353
Ig strand G 2786..2789 CDD:409353
I-set 2889..2972 CDD:400151
Ig strand B 2905..2909 CDD:409353
Ig strand C 2918..2921 CDD:409353
Ig strand E 2942..2946 CDD:409353
Ig strand F 2956..2961 CDD:409353
Ig 2979..3061 CDD:472250
Ig strand B 2995..2998 CDD:409353
Ig strand C 3006..3010 CDD:409353
Ig strand E 3031..3035 CDD:409353
Ig strand G 3054..3057 CDD:409353
Ig 3067..3150 CDD:472250
Ig strand B 3083..3087 CDD:409353
Ig strand C 3095..3099 CDD:409353
Ig strand E 3120..3124 CDD:409353
Ig strand F 3134..3139 CDD:409353
Ig 3157..>3225 CDD:472250
Ig 3256..3330 CDD:472250
Ig strand B 3263..3267 CDD:409353
Ig strand C 3275..3279 CDD:409353
Ig strand E 3300..3304 CDD:409353
Ig strand F 3314..3319 CDD:409353
Ig strand G 3323..3326 CDD:409353
Ig 3336..3419 CDD:472250
Ig strand B 3352..3356 CDD:409353
Ig strand C 3364..3368 CDD:409353
Ig strand E 3389..3393 CDD:409353
Ig 3427..3510 CDD:472250
Ig strand B 3441..3445 CDD:409353
Ig strand C 3454..3458 CDD:409353
Ig strand E 3480..3484 CDD:409353
Ig strand G 3503..3506 CDD:409353
Ig 3517..3599 CDD:472250
Ig strand B 3532..3536 CDD:409353
Ig strand C 3544..3548 CDD:409353
Ig strand E 3569..3573 CDD:409353
Ig strand F 3583..3588 CDD:409353
Ig strand G 3592..3595 CDD:409353
I-set 3605..3688 CDD:400151
Ig strand B 3621..3625 CDD:409353
Ig strand C 3634..3637 CDD:409353
Ig strand E 3659..3662 CDD:409353
Ig strand G 3681..3684 CDD:409353
Ig 3694..3776 CDD:472250
Ig strand B 3710..3714 CDD:409353
Ig strand C 3721..3725 CDD:409353
Ig strand E 3746..3750 CDD:409353
Ig strand F 3760..3765 CDD:409353
Ig strand G 3769..3772 CDD:409353
I-set 3782..3864 CDD:400151
Ig strand B 3798..3802 CDD:409353
Ig strand C 3810..3813 CDD:409353
Ig strand E 3834..3838 CDD:409353
Ig strand F 3848..3853 CDD:409353
Ig strand G 3857..3860 CDD:409353
Ig 3875..3952 CDD:472250
Ig strand B 3886..3890 CDD:409353
Ig strand C 3897..3901 CDD:409353
Ig strand E 3922..3926 CDD:409353
Ig strand F 3936..3941 CDD:409353
Ig strand G 3945..3948 CDD:409353
Ig 3958..>4026 CDD:472250
Ig strand B 3974..3978 CDD:409353
Ig strand C 3986..3989 CDD:409353
Ig strand E 4010..4014 CDD:409353
Ig 4031..4113 CDD:472250
Ig strand B 4047..4051 CDD:409353
Ig strand C 4058..4062 CDD:409353
Ig strand E 4083..4087 CDD:409353
Ig strand F 4097..4102 CDD:409353
Ig strand G 4106..4109 CDD:409353
Ig 4119..4201 CDD:472250
Ig strand B 4135..4139 CDD:409353
Ig strand C 4147..4150 CDD:409353
Ig strand E 4171..4175 CDD:409353
Ig strand F 4185..4190 CDD:409353
Ig strand G 4194..4197 CDD:409353
Ig 4206..4289 CDD:472250
Ig strand B 4223..4227 CDD:409353
Ig strand C 4235..4238 CDD:409353
Ig strand E 4259..4263 CDD:409353
Ig strand F 4273..4278 CDD:409353
Ig strand G 4282..4285 CDD:409353
Ig 4294..4377 CDD:472250
Ig strand B 4311..4315 CDD:409353
Ig strand C 4323..4326 CDD:409353
Ig strand E 4347..4351 CDD:409353
Ig strand F 4361..4366 CDD:409353
Ig strand G 4370..4373 CDD:409353
Ig 4382..4465 CDD:472250
Ig strand B 4399..4403 CDD:409353
Ig strand C 4410..4414 CDD:409353
Ig strand E 4435..4439 CDD:409353
Ig strand F 4449..4454 CDD:409353
Ig strand G 4458..4461 CDD:409353
Ig 4470..4553 CDD:472250
Ig strand B 4487..4491 CDD:409353
Ig strand C 4499..4502 CDD:409353
Ig strand E 4523..4527 CDD:409353
Ig strand F 4537..4542 CDD:409353
Ig strand G 4546..4549 CDD:409353
Ig 4558..4641 CDD:472250
Ig strand B 4575..4579 CDD:409353
Ig strand C 4587..4590 CDD:409353
Ig strand E 4611..4615 CDD:409353
Ig strand G 4634..4637 CDD:409353
Ig 4646..4729 CDD:472250
Ig strand B 4663..4667 CDD:409353
Ig strand C 4675..4678 CDD:409353
Ig strand E 4699..4703 CDD:409353
Ig strand F 4713..4718 CDD:409353
Ig strand G 4722..4725 CDD:409353
Ig 4735..4817 CDD:472250
Ig strand B 4751..4755 CDD:409353
Ig strand C 4763..4766 CDD:409353
Ig strand E 4787..4791 CDD:409353
Ig strand F 4801..4806 CDD:409353
Ig strand G 4810..4813 CDD:409353
Ig 4823..4906 CDD:472250
Ig strand B 4839..4843 CDD:409353
Ig strand C 4851..4855 CDD:409353
Ig strand E 4876..4880 CDD:409353
Ig strand F 4890..4895 CDD:409353
Ig strand G 4899..4902 CDD:409353
Ig 4912..4995 CDD:472250
Ig strand B 4928..4932 CDD:409353
Ig strand C 4940..4944 CDD:409353
Ig strand E 4965..4969 CDD:409353
Ig strand F 4979..4984 CDD:409353
Ig strand G 4988..4991 CDD:409353
Ig 5012..5086 CDD:472250
Ig strand B 5017..5021 CDD:409353
Ig strand C 5031..5035 CDD:409353
Ig strand E 5056..5060 CDD:409353
Ig strand F 5070..5075 CDD:409353
Ig strand G 5079..5082 CDD:409353
Ig 5093..5178 CDD:472250
Ig strand B 5108..5112 CDD:409353
Ig strand C 5121..5125 CDD:409353
Ig strand E 5146..5152 CDD:409353
Ig 5181..5269 CDD:472250
Ig strand B 5200..5204 CDD:409353
Ig strand C 5213..5217 CDD:409353
Ig strand E 5236..5240 CDD:409353
Ig strand G 5262..5265 CDD:409353
Ig 5275..5360 CDD:472250
IG_like 5371..5452 CDD:214653
Ig strand B 5382..5386 CDD:409353
Ig strand C 5396..5400 CDD:409353
Ig strand E 5422..5426 CDD:409353
Ig strand F 5436..5441 CDD:409353
Ig strand G 5445..5448 CDD:409353
FN3 5456..5541 CDD:238020
Ig 5569..5630 CDD:472250
Ig strand B 5576..5580 CDD:409353
Ig strand C 5588..5592 CDD:409353
Ig strand E 5613..5617 CDD:409353
Ig 5834..5924 CDD:472250
Ig strand B 5851..5855 CDD:409353
Ig strand C 5864..5868 CDD:409353
Ig strand E 5890..5894 CDD:409353
Ig strand F 5904..5909 CDD:409353
Ig strand G 5917..5920 CDD:409353
I-set 6064..6154 CDD:400151
Ig strand B 6081..6085 CDD:409353
Ig strand C 6094..6098 CDD:409353
Ig strand E 6120..6124 CDD:409353
Ig strand F 6134..6139 CDD:409353
Ig strand G 6147..6150 CDD:409353
I-set 6196..6286 CDD:400151
Ig strand B 6214..6218 CDD:409353
Ig strand C 6227..6231 CDD:409353
Ig strand E 6252..6256 CDD:409353
Ig strand F 6266..6271 CDD:409353
Ig strand G 6279..6282 CDD:409353
I-set 6307..6402 CDD:400151
Ig strand B 6324..6328 CDD:409353
Ig strand C 6337..6341 CDD:409353
Ig strand E 6368..6372 CDD:409353
Ig strand F 6382..6387 CDD:409353
Ig strand G 6395..6398 CDD:409353
SH3_Obscurin_like 6538..6600 CDD:212958
RhoGEF 6633..6809 CDD:470622 25/165 (15%)
PH_Obscurin 6818..6942 CDD:270059 25/130 (19%)
IgI_1_Titin-A168_like 6950..7040 CDD:409563 24/101 (24%)
Ig strand A' 6955..6961 CDD:409563 1/5 (20%)
Ig strand B 6966..6974 CDD:409563 3/7 (43%)
Ig strand C 6980..6985 CDD:409563 1/4 (25%)
Ig strand C' 6988..6990 CDD:409563 0/1 (0%)
Ig strand D 6996..7003 CDD:409563 2/6 (33%)
Ig strand E 7006..7012 CDD:409563 1/5 (20%)
Ig strand F 7019..7027 CDD:409563 4/7 (57%)
Ig strand G 7030..7040 CDD:409563 3/12 (25%)
I-set 7044..7126 CDD:400151 20/84 (24%)
Ig strand B 7061..7065 CDD:409353 0/3 (0%)
Ig strand C 7074..7078 CDD:409353 0/3 (0%)
Ig strand E 7101..7105 CDD:409353 1/6 (17%)
Ig strand F 7115..7120 CDD:409353 2/4 (50%)
Ig strand G 7128..7131 CDD:409353 1/2 (50%)
I-set 7297..7386 CDD:400151
Ig strand B 7314..7318 CDD:409353
Ig strand C 7327..7331 CDD:409353
Ig strand E 7353..7356 CDD:409353
Ig strand F 7366..7371 CDD:409353
Ig strand G 7379..7382 CDD:409353
Protein Kinases, catalytic domain 7404..7660 CDD:473864
Ig 8374..8453 CDD:472250
Ig strand B 8388..8392 CDD:409353
Ig strand C 8401..8405 CDD:409353
Ig strand E 8426..8431 CDD:409353
Ig strand F 8441..8446 CDD:409353
Ig strand G 8455..8458 CDD:409353
FN3 8465..8543 CDD:214495
Protein Kinases, catalytic domain 8577..8833 CDD:473864
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.