DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and wrapper

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:540 Identity:117/540 - (21%)
Similarity:192/540 - (35%) Gaps:124/540 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LAEMQNKDELLEDIREDTVVNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRV 166
            |.::|.:.:...|:.     |:...|.:|...:..:|.||.      |.|.::....| :.|.| 
  Fly    18 LGQVQAELDFNNDLE-----NSQKFKSIPTTVKTYENDTVQ------LPCTLNTPFRY-VRWHR- 69

  Fly   167 DTQTILTIQNHVITKNHRMSITHAEKRAW---ILRIRDVKESDKGWYMCQINTDPMKSQVGY--- 225
            |...::..::..:....|:.:       |   .|::.:|:.||.|.|.|::|:|.     |:   
  Fly    70 DDVALVDSRHPELPPPDRIML-------WPNGSLQVANVQSSDTGDYYCEMNSDS-----GHVVQ 122

  Fly   226 ---LDVVVPPDILDYPTS-TDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAY 286
               ::|.:.|.:|..|:. |:.  |.|:...:.|.|.|.|.|.||||..|..:.|..|..     
  Fly   123 QHAIEVQLAPQVLIEPSDLTEQ--RIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQSNTG----- 180

  Fly   287 NGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQS 351
            |...|.:...:|...|...|:||||:.......|.|.|.|.|.:.|...:|...|.....|||..
  Fly   181 NRQSLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIV 245

  Fly   352 EAYPKSINYWMKNDTIIVPGERFVPETFESGYK-----------ITMRLTIYEVDIQDFGAYRCV 405
            ||.|.:...|..:...:..|..  ..|.||..:           :...|.:..|...|.|.|.|.
  Fly   246 EAAPAATVKWFHHGLPVALGAH--STTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECR 308

  Fly   406 AKNSLGDTDGAIKLYHIP------------QTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQN 458
            |.|.:....|:::|...|            .:|:...:..|.|:..:....:|:.:......::.
  Fly   309 ASNQISVKSGSVELTGRPMPCLFKINPGTQSSTSHVLVWQTESLLPIMEFKLKFRQIPSNNVTRQ 373

  Fly   459 SNTN------PYNFNPGNSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSL-WNSQDHHSSSS 516
            ..||      |.....|.....|....|        ..|:.|..|.|.|.:|. |          
  Fly   374 VRTNWTELTIPAQATNGLIYITTYTLHG--------LQPASLYEVSVLARNSFGW---------- 420

  Fly   517 SSSSASSRGRDHHQQQHHQQQQQNHGSDHGASYR-SDGKSPHLTNHDAKS-LTDDLDRMQDLKGW 579
                                      ||:....| :.|....|.|:..:| |.||...    :.:
  Fly   421 --------------------------SDNSKIVRFATGGEVELPNYSTESELQDDFTE----EDF 455

  Fly   580 ASRLSPISPILGLSMILGVG 599
            .:.::..|.:|..||:...|
  Fly   456 HNEITQRSEVLSASMMFNSG 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 22/101 (22%)
IG_like 137..230 CDD:214653 22/101 (22%)
IG_like 240..324 CDD:214653 26/84 (31%)
IGc2 247..310 CDD:197706 19/62 (31%)
Ig 327..419 CDD:299845 24/102 (24%)
IG_like 343..420 CDD:214653 20/87 (23%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 22/102 (22%)
IG_like 41..118 CDD:214653 21/96 (22%)
IG_like 145..218 CDD:214653 25/77 (32%)
Ig 147..219 CDD:299845 24/76 (32%)
I-set 224..323 CDD:254352 23/100 (23%)
IGc2 236..314 CDD:197706 19/79 (24%)
FN3 339..431 CDD:238020 20/135 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.