DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and LRIT3

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 / 345193 HGNCID:24783 Length:679 Species:Homo sapiens


Alignment Length:429 Identity:85/429 - (19%)
Similarity:163/429 - (37%) Gaps:115/429 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHV----------ITKNHRMSIT 188
            ||..|:.|...:..:.:.|:..:......:| |:.|.:....|.|          :.:.|.:.:.
Human    50 ELPTNLPVDTVKLRIEKTVIRRISAEAFYYL-VELQYLWVTYNSVASIDPSSFYNLKQLHELRLD 113

  Fly   189 HAEKRA--W-------ILRIRDVKESDKGWYMCQINTDPMKS-----QVGYLDV------VVPPD 233
            .....|  |       :||..|:..:       :|.:.|.::     .:.|||:      .:|||
Human   114 GNSLAAFPWASLLDMPLLRTLDLHNN-------KITSVPNEALRYLKNLAYLDLSSNRLTTLPPD 171

  Fly   234 ILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREG--------GELIPLPNGAE-AVAYNGS 289
            .|:  :.|.:|......:.|      ||:..|...::.        .::|.|....: |:.....
Human   172 FLE--SWTHLVSTPSGVLDL------SPSRIILGLQDNPWFCDCHISKMIELSKVVDPAIVLLDP 228

  Fly   290 FLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAY 354
            .:|.::..||          .||   :.:|..|.....|.:......:.:||..|:.|.|.:..:
Human   229 LMTCSEPERL----------TGI---LFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGF 280

  Fly   355 PKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKL 419
            |.....|.::|:..| ....:.|:.|.|.:.:: :::..:..:|.|.|:|.|||..|.::..:  
Human   281 PTPQITWTRSDSSPV-NYTVIQESPEEGVRWSI-MSLTGISSKDAGDYKCKAKNLAGMSEAVV-- 341

  Fly   420 YHIPQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNP-YNFNPGNSQQNTKLQRGKSN 483
                   |:|.:    .|.|.|:         ...:|:.:..:| ::..||:         |:|.
Human   342 -------TVTVL----GITTTPI---------PPDTSERTGDHPEWDVQPGS---------GRST 377

  Fly   484 SKGSDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSAS 522
            |..|             |:|.||:|....:||.|:|:.|
Human   378 SVSS-------------ASSYLWSSSFSPTSSFSASTLS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 19/122 (16%)
IG_like 137..230 CDD:214653 19/122 (16%)
IG_like 240..324 CDD:214653 16/92 (17%)
IGc2 247..310 CDD:197706 10/71 (14%)
Ig 327..419 CDD:299845 21/91 (23%)
IG_like 343..420 CDD:214653 18/76 (24%)
LRIT3NP_940908.3 LRR 1 56..79 2/22 (9%)
leucine-rich repeat 59..82 CDD:275378 2/23 (9%)
LRR_8 61..117 CDD:290566 7/56 (13%)
LRR 2 80..103 5/23 (22%)
leucine-rich repeat 83..106 CDD:275378 3/22 (14%)
LRR 3 104..128 3/23 (13%)
LRR_8 105..165 CDD:290566 11/66 (17%)
LRR_4 105..146 CDD:289563 7/47 (15%)
leucine-rich repeat 107..130 CDD:275378 3/22 (14%)
LRR 4 129..151 5/28 (18%)
LRR_4 131..170 CDD:289563 8/45 (18%)
leucine-rich repeat 131..154 CDD:275378 5/29 (17%)
LRR 5 152..175 7/24 (29%)
leucine-rich repeat 155..168 CDD:275378 3/12 (25%)
Ig 267..345 CDD:299845 20/88 (23%)
IG_like 267..345 CDD:214653 20/88 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..375 5/41 (12%)
FN3 486..550 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.