DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr19

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:302 Identity:64/302 - (21%)
Similarity:124/302 - (41%) Gaps:67/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FGELLQ------NVTVPVSRE---AVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSI 187
            ||..||      |.|..::::   |:|.|||.......::|:|.....:||:.....:.:.|..:
  Fly    34 FGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLV 98

  Fly   188 THAEKRA-WILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNV 251
            .|..... |.|||:.|:|.|:|:|.||::..|.:|.|  :::.:...:.:..::.::.|.|.|.:
  Fly    99 EHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIV--IELKIVEAVAEISSAPELHIDETSTL 161

  Fly   252 TLKC---AATGSP--------TPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYL 305
            .|:|   .||.:|        :..|.:..:||.::  .:..::...:|.|...:..|:       
  Fly   162 RLECKLKRATENPAFVFWYHDSKMINYDSQGGFVV--TSIGQSNPQSGQFYRSSPANK------- 217

  Fly   306 CIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVP 370
               |....|..|...:|           |.|:|:    :..::..:...|.|..|          
  Fly   218 ---SRATMPMESSNGVL-----------NSLLGS----SDAIKAPAANVPSSTPY---------- 254

  Fly   371 GERFVPETFESGYKITMR---LTIYEVDIQDFGAYRCVAKNS 409
                :.:..:|.|.:...   ||:.:|:.:..|.|.|...|:
  Fly   255 ----MTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 28/102 (27%)
IG_like 137..230 CDD:214653 28/102 (27%)
IG_like 240..324 CDD:214653 18/94 (19%)
IGc2 247..310 CDD:197706 13/73 (18%)
Ig 327..419 CDD:299845 15/86 (17%)
IG_like 343..420 CDD:214653 12/70 (17%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 22/76 (29%)
IGc2 55..125 CDD:197706 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.