DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr2

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:338 Identity:86/338 - (25%)
Similarity:129/338 - (38%) Gaps:89/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ATAAVVSIICLSLALPGCAAQESDDEGELHHLDQMHHQHQDFIIGESEEHDHI--AHHLAEMQNK 108
            ||..:|.:|.:|.|.                  .|..||....|   ::|..:  ..||.:  ..
  Fly    12 ATPILVIMISISRAW------------------TMQQQHLSPAI---QQHPAVKSLSHLVD--GN 53

  Fly   109 DELL------EDIREDTVVNAIPEKDLPKFGELL--------------------------QNVTV 141
            |.||      ..|..|.|..|...:..|:||..:                          :|:|.
  Fly    54 DNLLPMVSAPSSIDNDYVYIASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITT 118

  Fly   142 PVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITH-AEKRAWILRIRDVKES 205
            .....|.:.|.||||....::|:|.....|||......|.:.|..:.. |:.:.|.|.::..:..
  Fly   119 RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPR 183

  Fly   206 DKGWYMCQINTDPMKSQVGYLDVVV-PPD---ILDYPTSTDMVIREGSNVTLKC-----AATGSP 261
            |.|.|.||:||:|..|....|:|:| |||   |:..|  ||:.::.||:|||.|     |.:...
  Fly   184 DSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGP--TDLYVKVGSSVTLTCHVKQPATSAQD 246

  Fly   262 TPTITWRREGGELIPL---PNGA----EAVAYNG-------SFLTIAKVNRLNMGAYLCIASNGI 312
            ...|.|.|....|.|.   ||.|    :.::...       |.|.||....|:.|.|.|:     
  Fly   247 IGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCM----- 306

  Fly   313 PPTVSKRVMLIVH 325
             ||.::...::|:
  Fly   307 -PTTAEAASVVVN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 29/93 (31%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 31/113 (27%)
Ig strand B 251..255 CDD:409275 3/3 (100%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 28/92 (30%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 2/7 (29%)
CDR1 130..136 CDD:409355 4/5 (80%)
FR2 137..151 CDD:409355 4/13 (31%)
Ig strand C 137..143 CDD:409355 1/5 (20%)
Ig strand C' 149..153 CDD:409355 2/3 (67%)
CDR2 153..162 CDD:409355 1/8 (13%)
Ig strand D 162..167 CDD:409355 0/4 (0%)
FR3 163..192 CDD:409355 7/28 (25%)
Ig strand E 172..178 CDD:409355 2/5 (40%)
Ig strand F 186..192 CDD:409355 3/5 (60%)
IG_like 220..306 CDD:214653 25/87 (29%)
Ig strand B 231..235 CDD:409353 3/3 (100%)
Ig strand C 261..265 CDD:409353 1/3 (33%)
Ig strand E 289..292 CDD:409353 1/2 (50%)
Ig strand F 302..307 CDD:409353 2/10 (20%)
Ig strand G 310..313 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.