DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and CG33543

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:399 Identity:91/399 - (22%)
Similarity:147/399 - (36%) Gaps:80/399 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 TIQNHVITK---------NHRMSITHAEKRA---WILRIRDVKESDKGWYMCQI--------NTD 217
            |:|..:.||         .:.....|.||:.   ..|....:...|:|.:.|::        |.:
  Fly    71 TVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVN 135

  Fly   218 PMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAE 282
            ..:..:...:::|...|....|.....:|||.:..:.|...|.|.|.::| ...||.|   |...
  Fly   136 VEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSW-LYNGEYI---NTVN 196

  Fly   283 AVAYN--GSFLTIAKVNRLNMGAYLCIASNGIPPTVSKR-----VMLIVHFPPMIW-----IQNQ 335
            :..:|  .:.|.|..|::.:.|.|.|.|.. |.||.|..     ::.|.|.|...:     :|..
  Fly   197 STKHNRLSNGLYIRNVSQADAGEYTCRAMR-ITPTFSDSDQITILLRIQHKPHWFFNETLPVQYA 260

  Fly   336 LVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFG 400
            .||.|    :.|.|.:...|.....|:.|:..||   .|....|.:.|..|::|.:  .:...||
  Fly   261 YVGGA----VNLSCDAMGEPPPSFTWLHNNKGIV---GFNHRIFVADYGATLQLQM--KNASQFG 316

  Fly   401 AYRCVAKNSLGDTDGAIKLYHIP----------------------QTTTMTTMAPTVSINTVPVV 443
            .|:|...|.||..:..|||...|                      ||..|:.::..:.|....|.
  Fly   317 DYKCKVANPLGMLERVIKLRPGPKPLGPRRFQLKKLYTNGFELDIQTPRMSNVSDEMQIYGYRVA 381

  Fly   444 LVKYNKEQRY--GSSQNSNTNPYNFNPGN-------SQQNTKLQRGKS-NSKG-SDQSPSGLNNV 497
            .:. :.|.::  |:...:....::|:.|.       ....|.|.|..| |..| ||.||..:...
  Fly   382 YMS-DTEFKFSAGNWSYAKQRDFSFHGGKHFIIPHLETNTTYLMRAASRNLAGLSDWSPVKVFTT 445

  Fly   498 FVGATSSLW 506
            ..|.:.|.|
  Fly   446 AAGCSWSPW 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 12/76 (16%)
Ig strand B 147..151 CDD:409353
Ig strand C 160..164 CDD:409353
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 1/4 (25%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 26/98 (27%)
Ig strand B 251..255 CDD:409275 0/3 (0%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 1/7 (14%)
Ig_3 327..408 CDD:464046 21/85 (25%)
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 10/51 (20%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 25/90 (28%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 1/4 (25%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 1/2 (50%)
IG_like 256..336 CDD:214653 25/88 (28%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 19/104 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.