DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr4

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:248 Identity:70/248 - (28%)
Similarity:101/248 - (40%) Gaps:46/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 QNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAE-KRAWILRIR 200
            :.||..|.:.|:|.|.|.||....::|:|.....|||:.....|.:.|....|:| ...|.|||.
  Fly    53 REVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRIS 117

  Fly   201 DVKESDKGWYMCQINTDPMKSQVGYLDVVVP-PDILDYPTSTDMVIREGSNVTLKCAATGSPTPT 264
            ..:..|.|.|.||::|:|..||...|:|||. ..||.   :.::.|:.||::.|.|.|..||.|.
  Fly   118 SPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILG---NAELFIKSGSDINLTCLAMQSPVPP 179

  Fly   265 --ITWRREGGELIPLPNGAEAVAYN--------------GSFLTIAKVNRLNMGAYLCIASNGIP 313
              |.|.:          |...:.|:              .|.|.|||....:.|.|.|      .
  Fly   180 SFIYWYK----------GKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTC------S 228

  Fly   314 PTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLEC----QSEAYPKSINYWM 362
            |:.|....::||.     |..:...|....|.:..|    .|.:.|..:..||
  Fly   229 PSSSDSASVVVHV-----INGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 33/93 (35%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 2/2 (100%)
Ig 232..324 CDD:472250 25/107 (23%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 1/5 (20%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 8/40 (20%)
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 32/91 (35%)
Ig strand A' 55..57 CDD:409355 1/1 (100%)
Ig strand B 61..69 CDD:409355 3/7 (43%)
CDR1 69..75 CDD:409355 3/5 (60%)
Ig strand C 76..82 CDD:409355 1/5 (20%)
CDR2 85..101 CDD:409355 4/15 (27%)
Ig strand D 101..106 CDD:409355 0/4 (0%)
FR3 102..131 CDD:409355 10/28 (36%)
Ig strand E 110..117 CDD:409355 3/6 (50%)
Ig strand F 125..132 CDD:409355 4/6 (67%)
IG_like 161..>227 CDD:214653 19/75 (25%)
Ig strand B 166..170 CDD:409353 1/3 (33%)
Ig strand C 181..185 CDD:409353 1/3 (33%)
Ig strand E 206..214 CDD:409353 2/7 (29%)

Return to query results.
Submit another query.