DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and musk

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001004503.1 Gene:musk / 334526 ZFINID:ZDB-GENE-030131-6458 Length:941 Species:Danio rerio


Alignment Length:293 Identity:76/293 - (25%)
Similarity:120/293 - (40%) Gaps:29/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRA 194
            |:...||:.|...:...|...|.||:.....|.|.|.:.........:||.:|.:|.|       
Zfish    26 PRITTLLETVDSSLDHNATFICEVDSYPQADIIWTRNNYPIRYYDSRYVIQENGQMLI------- 83

  Fly   195 WILRIRDVKESDKGWYMCQINTDPMKSQ-VGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAAT 258
                |.:||:||.|.|.|..|....::: .|.|.:.:.|.|..:||:..:::.  |...|.|.:.
Zfish    84 ----IPNVKDSDSGEYCCIANNGVGEAKSCGALQLKMKPQIKRHPTNMTLILE--SKAVLPCLSL 142

  Fly   259 GSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLI 323
            |.|.|.|:|.:| .:||. .|...|:..:|| |.|..:.:.:.|.|.|:|.|......|:.|.:.
Zfish   143 GYPKPEISWIKE-DDLIK-ANNRIAILESGS-LKITNIKKEDAGQYRCVARNSFGIAFSRPVTIE 204

  Fly   324 VHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPG---ERFVPETFESGYKI 385
            |..|..|....:.....:...:||||.:...|.....|::|...|...   |..|.|..      
Zfish   205 VQAPAKILKVPKEKRVQIGSEVTLECNATGNPIPSITWLENGNTISGASVVETLVGEVI------ 263

  Fly   386 TMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIK 418
               |::.:|.:.....|.|.|.|.....:..:|
Zfish   264 ---LSVLQVVVHKPALYTCQATNRHSGGENTVK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 24/93 (26%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/3 (0%)
Ig 232..324 CDD:472250 28/91 (31%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 18/83 (22%)
muskNP_001004503.1 Ig 32..113 CDD:472250 24/91 (26%)
Ig strand B 43..47 CDD:409353 1/3 (33%)
Ig strand C 56..60 CDD:409353 1/3 (33%)
Ig strand E 80..84 CDD:409353 2/14 (14%)
Ig strand F 94..99 CDD:409353 2/4 (50%)
Ig strand G 107..110 CDD:409353 0/2 (0%)
IgI_2_MuSK 119..206 CDD:409560 27/91 (30%)
Ig strand A 119..122 CDD:409560 1/2 (50%)
Ig strand A' 126..128 CDD:409560 0/1 (0%)
Ig strand B 134..142 CDD:409560 2/7 (29%)
Ig strand C 148..153 CDD:409560 2/4 (50%)
Ig strand C' 155..158 CDD:409560 0/2 (0%)
Ig strand D 163..167 CDD:409560 1/3 (33%)
Ig strand E 170..176 CDD:409560 4/6 (67%)
Ig strand F 183..191 CDD:409560 4/7 (57%)
Ig strand G 194..199 CDD:409560 0/4 (0%)
Ig strand G' 201..206 CDD:409560 1/4 (25%)
Ig 212..300 CDD:472250 18/91 (20%)
Ig strand B 226..230 CDD:409353 2/3 (67%)
Ig strand C 239..243 CDD:409353 0/3 (0%)
Ig strand E 260..264 CDD:409353 1/12 (8%)
Ig strand F 276..281 CDD:409353 2/4 (50%)
Ig strand G 293..296 CDD:409353 1/1 (100%)
CRD_TK_ROR_related 309..449 CDD:143578
KR 454..536 CDD:214527
PTKc_Musk 640..930 CDD:133181
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.