DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and DIP-beta

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:483 Identity:173/483 - (35%)
Similarity:244/483 - (50%) Gaps:83/483 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LLEDIREDTVVNAIPEKDL--PKFGELLQNVTVPVSREAVLQCVVDNLQTY-----------KIA 162
            ||.:..:.||.|.|.....  |.|...|:|||:...|:|...|||:||..:           |:|
  Fly    77 LLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVA 141

  Fly   163 WLRVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLD 227
            |::.|.:.||.|..||||.|.|:|:.|.:...|.|.||.||..|.|.||||:||||||.|...|:
  Fly   142 WIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLE 206

  Fly   228 VVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGA----EAVAYNG 288
            ||:||||::..||.||::.||.:..|.|.|.|.|.|.||||||.|..|...||:    :|.:..|
  Fly   207 VVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEG 271

  Fly   289 SFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEA 353
            ..||::|:.|..||||:||||||:|||||||:.|.|||.|::.:.||||||.:..::||.|..||
  Fly   272 EMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEA 336

  Fly   354 YPKSINYWMK-NDTIIVPGERF-VPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGA 416
            .||:||||.: |..:|:.|:|: :.|...:.|.|.|.|.|..:...|||.|:|::|||:|||:|.
  Fly   337 SPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGT 401

  Fly   417 IKLYHIPQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSS--QNSNTNPYNFNPGNSQQNTKLQR 479
            |:||.:                            :|.|..  ::.:.|..:.|. ..|::|:.:.
  Fly   402 IRLYEM----------------------------ERPGKKILRDDDLNEVSKNE-VVQKDTRSED 437

  Fly   480 GKSNSKG-------SDQSPSGLNNVFVG--------------------------ATSSLWNSQDH 511
            |..|..|       .||.|:..::..:|                          .|.|.......
  Fly   438 GSRNLNGRLYKDRAPDQHPASGSDQLLGRGTMRLIGTFLLALLVLFTALAEAGPTTLSCRTKGGR 502

  Fly   512 HSSSSSSSSASSRGRDHHQQQHHQQQQQ 539
            ...:..:|....|.||..:..|..:.:|
  Fly   503 QKKAKETSWNGRRARDGREDGHAAEWRQ 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 46/103 (45%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 2/3 (67%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 3/4 (75%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 49/95 (52%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 2/3 (67%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 3/4 (75%)
Ig strand G 317..320 CDD:409275 2/2 (100%)
Ig_3 327..408 CDD:464046 33/82 (40%)
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 49/110 (45%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 2/3 (67%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 3/4 (75%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 49/95 (52%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 3/4 (75%)
Ig strand G 300..303 CDD:409353 2/2 (100%)
IG_like 327..405 CDD:214653 34/77 (44%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 4/4 (100%)
Ig strand E 365..376 CDD:409353 4/10 (40%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.