DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and CG6867

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster


Alignment Length:293 Identity:95/293 - (32%)
Similarity:138/293 - (47%) Gaps:52/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 DVVVPPDILDYPT---STDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNG 288
            |:::||.|.|...   ...:::.||.::.|.|.|||:|||.:.||||.|..|.: ||.|..:.:|
  Fly   426 DLLIPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINV-NGVEMASISG 489

  Fly   289 SFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEA 353
            .||....:.|..|.||.|.|:|||.|..:...::.|.|.|||.:..|::.|....:.||||..||
  Fly   490 QFLRFTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEA 554

  Fly   354 YPKSINYWMK--NDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGA 416
            :|::|.||.:  :..|:.|.:::..|::..|:|.||||||..:...|||.|.|||:|.|.     
  Fly   555 FPEAIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELN----- 614

  Fly   417 IKLYHIPQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNPYNFNPGNSQQNTKLQRGK 481
                           |..|:....|             ...||.| ||   .||:.:....:..:
  Fly   615 ---------------ATMVNFEIAP-------------QDPNSET-PY---VGNNMKVYGQRPPE 647

  Fly   482 SNSKGSDQSP---------SGLNNVFVGATSSL 505
            |.....||.|         |.|||..:.||.:|
  Fly   648 SECPVCDQCPDPSLYQCKDSILNNFEIQATGNL 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 1/2 (50%)
Ig strand B 147..151 CDD:409353
Ig strand C 160..164 CDD:409353
Ig strand E 195..199 CDD:409353
Ig strand F 209..214 CDD:409353
Ig strand G 221..224 CDD:409353
Ig 232..324 CDD:472250 35/94 (37%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 3/4 (75%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 33/82 (40%)
CG6867NP_573262.2 gly_rich_SclB <257..>409 CDD:468478
Ig 436..525 CDD:472250 32/89 (36%)
Ig strand B 453..457 CDD:409353 1/3 (33%)
Ig strand C 466..470 CDD:409353 0/3 (0%)
Ig strand E 490..494 CDD:409353 2/3 (67%)
Ig strand F 504..509 CDD:409353 3/4 (75%)
Ig strand G 518..521 CDD:409353 0/2 (0%)
Ig_3 529..611 CDD:464046 33/81 (41%)
OLF 694..939 CDD:460482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.