DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr8

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:218 Identity:68/218 - (31%)
Similarity:95/218 - (43%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KDLPKFG--------ELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNH 183
            :|||..|        .:..|:|..|.:...|.|.|.||....::|:|.....:||:..:..|.:.
  Fly    32 QDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQ 96

  Fly   184 R---MSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVP-PDILDYPTSTDMV 244
            |   |...|||.  |.||||..:..|.|.|.|||:|.|......||::|.| .||:..|   ::.
  Fly    97 RFEAMHSPHAED--WTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGP---ELH 156

  Fly   245 IREGSNVTLKCAA--TGSPTPTITWRREGGELIPLPN---GAEAVAYNG----SFLTIAKVNRLN 300
            |..||.:.|.|..  ...|.||:.| ....|:|...:   |...|...|    |.|.:.|....:
  Fly   157 INRGSTINLTCIVKFAPEPPPTVIW-SHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQD 220

  Fly   301 MGAYLCIASNGIPPTVSKRVMLI 323
            .|.|.|..||..|.:|  ||.::
  Fly   221 SGLYTCTPSNANPTSV--RVHIV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 33/95 (35%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 29/101 (29%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046
dpr8NP_727781.1 IG_like 51..131 CDD:214653 29/81 (36%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 0/3 (0%)
Ig strand E 109..113 CDD:409353 2/3 (67%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.