DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Negr1

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:308 Identity:97/308 - (31%)
Similarity:148/308 - (48%) Gaps:27/308 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIR 200
            :.|:.|.....|||:|.::: ...|.|||  :..:|:.......:.:.|:||:...||.:.|:|:
Mouse    39 VDNMLVRKGDTAVLRCYLED-GASKGAWL--NRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQ 100

  Fly   201 DVKESDKGWYMCQINTD--PMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTP 263
            :|..:|.|.|.|.:.|.  |...|| :|.|.|||.|  |..|.||.|.||:||||.|.|||.|.|
Mouse   101 NVDVTDDGPYTCSVQTQHTPRTMQV-HLTVQVPPKI--YDISNDMTINEGTNVTLTCLATGKPEP 162

  Fly   264 TITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPP 328
            .|:||.......|..        ||.:|.|..:.|...|.|.|.|.|.:.....|:|.:||:|.|
Mouse   163 VISWRHISPSAKPFE--------NGQYLDIYGITRDQAGEYECSAENDVSFPDVKKVRVIVNFAP 219

  Fly   329 MIWIQNQLVGAALT--QNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTI 391
            .|   .::....:|  ::..:.|:....|.....|.|.:..:..|::.:   ....:.....||:
Mouse   220 TI---QEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKRLFNGQQGI---IIQNFSTRSILTV 278

  Fly   392 YEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTT---MTTMAPTVS 436
            ..|..:.||.|.|||.|.||.|:.::.|..|.:.||   :|:.||:.:
Mouse   279 TNVTQEHFGNYTCVAANKLGTTNASLPLNQIIEPTTSSPVTSPAPSTA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 29/94 (31%)
IG_like 137..230 CDD:214653 29/94 (31%)
IG_like 240..324 CDD:214653 32/83 (39%)
IGc2 247..310 CDD:197706 25/62 (40%)
Ig 327..419 CDD:299845 21/93 (23%)
IG_like 343..420 CDD:214653 18/76 (24%)
Negr1XP_036019026.1 FR1 38..55 CDD:409353 5/15 (33%)
Ig strand A' 40..46 CDD:409353 2/5 (40%)
IG_like 41..129 CDD:214653 28/91 (31%)
Ig strand B 48..56 CDD:409353 4/7 (57%)
CDR1 56..60 CDD:409353 0/4 (0%)
FR2 61..68 CDD:409353 4/8 (50%)
Ig strand C 61..67 CDD:409353 4/7 (57%)
CDR2 69..79 CDD:409353 1/9 (11%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 12/34 (35%)
Ig strand D 84..91 CDD:409353 3/6 (50%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 4/9 (44%)
FR4 122..129 CDD:409353 3/7 (43%)
Ig strand A' 139..144 CDD:409353 3/4 (75%)
IGc2 146..204 CDD:197706 26/65 (40%)
Ig strand B 150..157 CDD:409353 4/6 (67%)
Ig strand C 163..168 CDD:409353 2/4 (50%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand E 180..186 CDD:409353 2/5 (40%)
Ig strand F 193..200 CDD:409353 3/6 (50%)
Ig_3 219..295 CDD:404760 17/81 (21%)
putative Ig strand A 219..225 CDD:409353 2/8 (25%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10599
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.