DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and CG15312

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster


Alignment Length:456 Identity:89/456 - (19%)
Similarity:137/456 - (30%) Gaps:182/456 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 STDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAY 304
            :||    :|.||::.|.|.|:    |.|.:|.|       ....:...|..|.:..|:..:.|.|
  Fly    36 ATD----KGGNVSIPCIAQGN----IMWVKEHG-------NNSTIVQTGRVLVLRNVSTTDAGIY 85

  Fly   305 LCIASNGIPPTVS--------------------------------------------------KR 319
            :|.||...|.|.:                                                  :|
  Fly    86 VCFASVPRPSTTATSATTSPQNLQDKETRPLEDEDDGQGESVSPKDDQLKEAEMEEEVEYLAHQR 150

  Fly   320 VMLIVHFPP----------------MIWIQNQL-VGAALTQNITLECQSEAY---PKSINY---W 361
            ..|||...|                :||..|:. .|....::.|.|.::.:|   |.:.::   |
  Fly   151 TKLIVRTVPGPVSQLYFKASTILGFLIWRFNKTQSGGYPVRSFTAEYRNVSYKTPPANASFEHAW 215

  Fly   362 MKNDTIIVPGERFVPETFESGYKITMRL---TIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIP 423
            .:.|.|.:        .|........||   |.||        :|..|.|.||..:..       
  Fly   216 SRMDPINI--------AFNVRQMEVYRLAPNTTYE--------FRIWANNELGSGEVV------- 257

  Fly   424 QTTTMTTMA-------------------PTVSINTVPVVL-----------VKYNKEQRYGSSQN 458
             ||.:||:.                   |.:.|..|.:||           :..:|| .|.|:|.
  Fly   258 -TTNVTTLPETKEEDLIRLIKPDLDNFDPRIWIVAVSIVLGTLVILAIGLCIVLSKE-CYQSAQM 320

  Fly   459 SNTNPYN---------FNPGNSQQNTKLQRGKSNSKGS----DQSPSGLNNVFVGATSSLWNSQ- 509
            ...:.::         .|||.|:.:...:.|.....||    |......::|.:....::...| 
  Fly   321 ELQDGWDSIELIPNIILNPGFSESDGGPEPGGQGHGGSAGDQDAGEDDDDDVAMPFPRTIIFGQH 385

  Fly   510 -------------DHHSSSSSSSSASSRGRDHHQQQHHQQQQQNHGSDHGASYRSDGKSPHLTNH 561
                         .||...:.|         ||.|.||||.||.|...|......|....:...|
  Fly   386 HRTPPPPRLHLPPQHHRHQNQS---------HHHQYHHQQNQQQHHHHHLRRQDDDDDDDYEEEH 441

  Fly   562 D 562
            :
  Fly   442 E 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653
Ig strand B 147..151 CDD:409353
Ig strand C 160..164 CDD:409353
Ig strand E 195..199 CDD:409353
Ig strand F 209..214 CDD:409353
Ig strand G 221..224 CDD:409353
Ig 232..324 CDD:472250 24/133 (18%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/52 (0%)
Ig_3 327..408 CDD:464046 20/106 (19%)
CG15312NP_001245603.1 Ig 39..90 CDD:472250 16/61 (26%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 1/7 (14%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.